(data stored in ACNUC7421 zone)

EMBL: CP001600.PE636

CP001600.PE636       Location/Qualifiers
FT   CDS_pept        complement(671483..673774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0686"
FT                   /product="xanthine dehydrogenase, molybdenum-binding
FT                   subunit"
FT                   /EC_number="1.17.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67908"
FT                   /db_xref="GOA:C5B7N1"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N1"
FT                   /protein_id="ACR67908.1"
FT                   /translation="MSLGSPLRRVDAEAKVTGQARYTDDMMMPGMLHACYVRSRIAHGN
FT                   VTAIDTREAESMPGVEAVFTFHDVPSAPFPTAGHAWSLEPGKRDIADRHLLTGHVRHFG
FT                   DGVAIVVARDLLSAERAAARVQVSYDALPVITRPQAALADGAPAIHPGGNLLRHSEIDA
FT                   GEPEVRISTADLQLEGHYETPVVQHCHMEGVTCYAYMEQPDHIVIVSSTQIPQIVRRTV
FT                   AQALGLPWSHVRVIKPYVGGGFGNKQDVLEEPMAAFLTQRLGGKPVKVSLSREECFVAT
FT                   RTRHAFSIDARLGMRRDGQLEGYRLTVLSNTGAYASHGHSIAAAGANKISYLYPRSAFG
FT                   YCADTVYTNLPAAGAMRGYGAPQVDFALECLMDDAAARLDLDPLEVRLRNVARQGDRNP
FT                   VNGKTIYSAGLTECLEKGRRLFEWDQRRAECLAQAADAPVRRGIGIACFSYGSNTYPVG
FT                   VEIAGARLLLNQDGTVNLQIGATEIGQGSDTVFAQMASETLGIPFKQIRVISTQDTDIT
FT                   AFDPGAFASRQSYVAAPAIRRAAEIMRQKILAHAALISHQPEWGLTLCDGNVVMAMQPD
FT                   QVLMSVADVAMQAYYHQEIGAQILAEVSHKTTTNPPAFGCTFVDLSIDIALCQVTINRI
FT                   LNLHDSGRILNPQLAEGQVHGGMGMGIGWALFEEMIIDEQSGVVRNPNLLDYKFPTCVD
FT                   LPDLECAFVETVEPQSAYGHKALGEPPIISPGPAIRNAIRMATGVAINALPITPKTLYR
FT                   EFVQAGLIRE"
     atgtctttag gatcgccgct gcggcgggtt gatgccgaag ccaaggtcac cggacaggcg        60
     cgttataccg atgatatgat gatgcccggc atgctccatg cctgctacgt gcgcagccgt       120
     atcgcccacg gtaacgtcac cgccatcgat acccgggaag cggagtccat gcccggcgta       180
     gaagccgtct tcacctttca cgatgtcccc tcagccccct tccctactgc cggccacgcc       240
     tggtctctgg agccgggcaa acgggatatc gccgatcgcc atctgctgac cggccacgtg       300
     cgccactttg gcgacggcgt cgccatcgtc gtcgcccgcg atctgctcag cgccgagcgc       360
     gccgcggcgc gggtacaggt cagctatgat gcgttgccgg tgatcacccg gccacaggca       420
     gccctggctg acggtgcgcc agctattcac cccggcggca atttgctgcg ccacagcgag       480
     atcgacgccg gagagccaga agtccgcatc tccaccgccg atctgcagct ggagggtcac       540
     tacgagacgc cggtggtgca gcactgccac atggagggcg tgacctgcta tgcctatatg       600
     gagcagcccg atcacatcgt cattgtctcc agcacccaaa ttccccagat tgtccggcgc       660
     accgtcgccc aggccctcgg tctcccctgg tcgcacgtcc gggtgatcaa gccctacgtc       720
     ggcggcggat tcggtaataa gcaggatgtg ctggaagagc cgatggccgc ctttttaacc       780
     cagcgcctcg gcggtaaacc ggtcaaggtc agcctgagcc gggaggagtg cttcgtcgcc       840
     acccgcaccc gccacgcctt cagcatcgat gcccggctag gtatgcgccg ggatggccag       900
     ctggaggggt accggctgac ggtgctgtcc aacaccggcg cctatgcctc tcacggccac       960
     tcgattgccg ctgccggcgc caataaaatc agctatctct atccccgcag cgcctttggc      1020
     tactgcgctg atacggtgta taccaacctg cccgccgccg gtgcgatgcg cggctacggc      1080
     gcaccgcagg tcgactttgc cctggaatgc ctgatggacg acgccgcggc ccgcctcgat      1140
     ctcgatcccc tcgaggttcg tctgcgcaac gtcgcgcgtc agggcgaccg caacccggtt      1200
     aacggaaaga ccatctacag cgccgggctc acagagtgcc tggaaaaagg ccgccgtctg      1260
     tttgagtggg atcagcgccg cgccgaatgt ctggcccagg cggccgatgc gccggtgcgg      1320
     cgcggcatcg gcatcgcctg tttcagctat ggttccaata cctatccggt cggggtggag      1380
     atcgccggcg cccgcctgct gctcaatcag gacgggacgg taaacctgca gattggcgcc      1440
     accgaaattg gccaggggtc cgataccgtc ttcgcccaga tggcatcgga aacgctgggg      1500
     atccccttta aacagatccg ggtgatctca actcaggata ccgatatcac cgccttcgat      1560
     cccggcgcct ttgcctcacg gcaaagctac gtcgccgccc cggcgatccg ccgagcagcg      1620
     gagatcatgc gccagaagat cctggcgcac gcggcgctga taagccacca gccggagtgg      1680
     ggactgaccc tgtgcgacgg taacgtggtg atggcgatgc agccggatca ggtgctgatg      1740
     agcgtcgccg acgtcgccat gcaggcctac taccaccagg agatcggcgc acagatcctg      1800
     gccgaggtct cccataaaac caccaccaat cccccggctt tcggctgcac ctttgtcgat      1860
     ctcagcatcg acatcgcgct atgccaggtc actattaacc gcatcctgaa tctgcatgac      1920
     tccgggcgga tcctcaaccc gcagctggcg gagggacagg ttcacggcgg catgggtatg      1980
     gggatcggct gggcgctgtt cgaagagatg atcatcgatg agcagagtgg cgtggtacgc      2040
     aatccgaatc tgctcgacta caaattcccc acctgtgtcg acctgccgga tctggagtgc      2100
     gcctttgtcg agacggtgga gccgcagtca gcctatggcc acaaggcgct gggagagccg      2160
     ccgatcattt cgcctggacc ggcgatccgc aacgccattc gcatggcaac gggggtcgcg      2220
     atcaatgcgc tgccgatcac ccccaaaacg ctgtatcgcg aatttgtgca ggccggactg      2280
     atcagggagt aa                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page