(data stored in ACNUC7421 zone)

EMBL: CP001600.PE638

CP001600.PE638       Location/Qualifiers
FT   CDS_pept        675154..675315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0688"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67910"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N3"
FT                   /protein_id="ACR67910.1"
FT                   /translation="MAIFSVYLLFPPLHCPHIDFFSEKTHYSAVAFDICVRQPFSPFLK
FT                   LAFLITWH"
     atggcaattt tttctgttta ccttttattt cccccgctgc actgcccgca tattgatttt        60
     ttcagtgaaa aaacgcatta tagcgccgtt gcctttgata tctgtgtccg gcaaccgttt       120
     tctcctttct taaaattggc gtttttaatc acttggcatt aa                          162
//

If you have problems or comments...

PBIL Back to PBIL home page