(data stored in ACNUC7421 zone)

EMBL: CP001600.PE639

CP001600.PE639       Location/Qualifiers
FT   CDS_pept        675503..676660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0689"
FT                   /product="carbamoyl-phosphate synthase, small subunit,
FT                   putative"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0689"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67911"
FT                   /db_xref="GOA:C5B7N4"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N4"
FT                   /protein_id="ACR67911.1"
FT                   /translation="MIKSALLVLEDGTQFHGRSIGADGSAVGEVVFNTSMTGYQEILTD
FT                   PSYSRQIVTLTYPHIGNVGTNAADEESSTVHAQGLIVRDLPPIASNFRCQETLPDYLRR
FT                   HRVVAIADIDTRKLTRLLREKGAMNGCIVTAENGSEPDAALALEKARAFPGLKGMDLAK
FT                   EVTTKEAYRWCQGSWTLSGGLPAPRDDAELPYHVVAYDFGVKRNILRMLVDRGCRLTVV
FT                   PAQTPAQDVLALDPDGIFLSNGPGDPAPCDYAIEAIATFLRGEIPLFGICLGHQLLALA
FT                   SGAQTVKMKFGHHGGNHPVKDLEGDRVMITAQNHGFAVDEATLPTTLRATHKSLFDGSL
FT                   QGIHRTDRPAFSFQGHPEASPGPHDAAPLFDHFMTLIENYRRTAK"
     ttgattaagt cagcgctttt ggttctggaa gacggaaccc agtttcacgg caggtcgatc        60
     ggggcagatg gctcggccgt gggggaagtg gtcttcaata cctcgatgac cggctaccag       120
     gaaattctca ccgacccctc ctattcccgc cagatcgtca cgcttaccta tccccatatt       180
     ggcaatgtcg gcaccaacgc cgccgatgaa gaatcctcca ccgtgcatgc tcaggggctt       240
     atcgtgcgcg atctgccgcc gatcgccagc aatttccgct gccaggagac gctgccggac       300
     tatctgcgtc gtcaccgcgt ggtcgccatc gctgatatcg atacccgtaa gctgacccgt       360
     ctgctgcgtg agaaaggggc gatgaacggc tgtatcgtca ccgcagagaa tgggagcgag       420
     ccagacgcgg cgctggctct ggagaaggcg cgcgcgttcc ccggcctgaa agggatggat       480
     ttggccaaag aagtgaccac gaaggaggcc tataggtggt gccagggcag ctggacgctc       540
     agcggcggcc tgccagcgcc gcgtgacgac gccgaactgc cttaccatgt cgtggcctat       600
     gactttggcg tgaagcgcaa tatcctgcga atgctggtgg atcgcggctg ccgcctgacg       660
     gtagtaccgg cccagacgcc tgcacaggat gtgctggcgc tggatccgga cggtattttc       720
     ctttccaacg gtcccggcga tccggcccct tgtgactatg ctatcgaggc tatcgcgacc       780
     ttcctgcgcg gagagatccc gctgtttggc atctgccttg ggcatcagct gctggcgctg       840
     gccagcggtg cgcagacggt aaaaatgaag tttggccatc acggcggcaa ccatccggtg       900
     aaagatttag agggcgatcg ggtaatgatc accgcgcaga accacggttt tgccgttgat       960
     gaagcgacct tgccgacgac gctgcgggcg acccataagt cgctgttcga cggctcgctg      1020
     cagggcattc accgtaccga tcgtccggcg ttcagtttcc agggacaccc ggaggccagc      1080
     ccgggaccgc acgacgccgc cccgctgttt gaccatttta tgacgctgat tgaaaactat      1140
     cgccgtaccg ccaagtaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page