(data stored in ACNUC7421 zone)

EMBL: CP001600.PE64

CP001600.PE64        Location/Qualifiers
FT   CDS_pept        complement(58527..58916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0067"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67327"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB92"
FT                   /protein_id="ACR67327.1"
FT                   /translation="MLTTLAAGTYGIPTITSNINGLPETVRHQQIGFCLTPTLSVEQYA
FT                   NISAASIDFSPQVYDPVQDRLTPPLILSPEQLADSIESLYRNPETYRRLSDGAREYAAV
FT                   SRCFNDLAQTLCQRLLTRADPRPHG"
     atgctaacca cgctagcggc tggaacctat gggatcccaa ctatcaccag taatatcaat        60
     ggcctgccgg aaaccgttcg ccaccagcag atagggttct gtctcacccc gacgctctcg       120
     gtcgagcagt atgccaatat cagcgccgcc tccatcgatt tctcaccgca ggtctacgat       180
     ccggtgcagg atcggctaac cccgccgtta atcctgtcac ccgagcagct cgcggatagc       240
     attgagtctc tctatcgcaa cccggagacc taccggcgac tgagcgacgg cgcccgcgaa       300
     tacgccgccg tcagccgatg ttttaacgac ctcgcgcaga cgctgtgtca gcgtctactc       360
     acgcgggctg atccccgccc gcacggctaa                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page