(data stored in ACNUC7421 zone)

EMBL: CP001600.PE640

CP001600.PE640       Location/Qualifiers
FT   CDS_pept        676680..679901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0690"
FT                   /product="carbamoyl-phosphate synthase, large subunit,
FT                   putative"
FT                   /EC_number="6.3.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0690"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67912"
FT                   /db_xref="GOA:C5B7N5"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N5"
FT                   /protein_id="ACR67912.1"
FT                   /translation="MPKRTDIKSILILGAGPIVIGQACEFDYSGAQACKALREEGYRVV
FT                   LVNSNPATIMTDPEMADATYIEPIHWEVVRKIIEKERPDAVLPTMGGQTALNCALELER
FT                   QGVLAEFGVTMIGATADAIDKAEDRRRFDQAMKKIGLDTARSGIAHSMEESLAVAEQVG
FT                   FPCIIRPSFTMGGTGGGIAYNREEFEEICARGLDLSPTNELLIDESLIGWKEYEMEVVR
FT                   DKNDNCIIVCAIENIDPMGIHTGDSITVAPAQTLTDKEYQIMRNASMAVLREIGVETGG
FT                   SNVQFAVNPKSGRLIVIEMNPRVSRSSALASKATGFPIAKVAAKLAVGYTLDELMNDIT
FT                   GGRTPASFEPSIDYVVTKIPRFNFEKFAGANDRLTTQMKSVGEVMAIGRTQQESLQKAL
FT                   RGLEVGASGFDPKVNLDDPQALTKIRRELKDAGAERIWYIADAFRAGLSVDGVFNLTNI
FT                   DRWFLVQIEELVRLEEQVADVGINGLTPDFLRQLKRKGFADARLARLAGVAESEIRKLR
FT                   HKQGLHPVYKRVDTCAAEFATDTAYLYSTYEEECEANPTHDRPKIMVLGGGPNRIGQGI
FT                   EFDYCCVHASLALREDGYETIMVNCNPETVSTDYDTSDRLYFEPVTLEDVLEIVAVERP
FT                   QGVIVQYGGQTPLKLARALEAAGVPVIGTSPDAIDRAEDRERFQKAVNRLGLKQPANAT
FT                   VTAIEQAVEKGAQIGYPLVVRPSYVLGGRAMEIVYDESDLRRYFQTAVSVSNDAPVLLD
FT                   HFLDDAVEVDVDAICDGERVLIGGIMEHIEQAGVHSGDSACSLPAYTLSAEIQDELRRQ
FT                   AEKLAMELCVRGLMNVQFAVKDNQVYLIEVNPRAARTVPFVSKATGVPLAKVAARVMVG
FT                   QTLAQQGMTEEVIPPYYSVKEVVLPFAKFPGVDPILGPEMRSTGEVMGVGRTFAEAFAK
FT                   AMLGSLSQVKTPGRALLSVREGDKHRVVDLAAKLLRQGFELDATHGTAVVLGEAGINPR
FT                   LVNKVHEGRPHIQDRIKNGEYTYIVNTTAGRQAIEDSKLIRRSALRYKVHYDTTLNGGF
FT                   ATAMALNADPTEQVISVQEMHARLK"
     atgccaaaac gtactgatat taaaagcatc ctgatcctgg gcgccgggcc gatcgtcatc        60
     ggccaggcgt gcgagttcga ctactctggc gctcaggcct gtaaggcgct acgcgaagag       120
     ggctaccgcg tcgtcctggt taactccaac ccggccacca tcatgaccga tccggagatg       180
     gccgatgcga cctatattga gccgattcac tgggaagtgg tgcgaaagat catcgaaaaa       240
     gagcgccccg atgcggtgct gccgacgatg ggcggccaga cggcgctgaa ctgtgccctg       300
     gagctggagc gccagggggt actggccgag ttcggtgtga ccatgattgg ggcgacggcg       360
     gatgccatcg ataaggctga ggatcgacgg cgtttcgacc aagcgatgaa gaagatcggg       420
     ctggataccg cgcgttccgg cattgcccac agtatggaag agtcgctggc ggtggctgag       480
     caggtcggtt tcccctgcat tatccgtccg tcgtttacga tgggcggcac cggcggcggt       540
     attgcttata atcgcgaaga gtttgaagag atctgcgcac gcggcctgga tctttcgccg       600
     accaatgagc tgctgatcga tgagtctctg atcggctgga aagagtatga gatggaggtg       660
     gtgcgcgata agaacgacaa ctgcatcatc gtctgcgcca tcgaaaatat tgatccgatg       720
     gggatccaca ccggcgactc gattaccgtc gcgccggcgc agaccctgac cgataaagag       780
     taccaaatca tgcgtaacgc ctcgatggcg gtactgcgtg agatcggcgt ggagaccggc       840
     ggctccaacg tgcagtttgc ggttaacccg aaaagcggcc gtctcatcgt tatcgagatg       900
     aacccgcgcg tatcacgttc ttccgcgctg gcctccaagg cgaccggttt cccgatcgcc       960
     aaggttgcag ccaagctggc ggtgggctac accctagacg agctgatgaa cgacatcacc      1020
     ggggggcgta cgccggcctc ctttgaaccc tccatcgact acgtggtgac gaagatcccg      1080
     cgcttcaact ttgaaaagtt tgccggggct aacgatcgcc tgaccacgca gatgaagtcg      1140
     gtgggtgagg tgatggcgat tggccgtacc cagcaggagt cgctgcagaa ggcgctgcgc      1200
     gggctggagg tcggggcgag tggcttcgat cccaaggtaa atttggacga tccgcaggcg      1260
     ttgaccaaga tccgacgcga gctgaaagat gccggtgcag agcgtatctg gtatatcgcc      1320
     gatgccttcc gcgccggtct gtcggtggat ggggtgttta acctgaccaa catcgatcgc      1380
     tggttcctgg tgcagatcga ggagctggtg cgtctggagg agcaggttgc cgacgtgggc      1440
     atcaatggcc tgacgccgga tttcctgcgt cagctgaagc gtaaagggtt cgccgatgcc      1500
     cgtctggccc gtctggccgg tgtggcggag agcgagattc gcaagctacg ccataagcag      1560
     gggctgcatc cggtatataa acgcgtggac acctgcgcgg ccgaattcgc gaccgacacg      1620
     gcttaccttt actccaccta tgaagaggag tgcgaggcta acccgactca cgatcgccca      1680
     aagatcatgg tgctgggcgg tggcccgaac cgtatcggtc aggggatcga gtttgactac      1740
     tgctgcgtgc acgcgtcgct ggcgctgcgt gaggatggct atgaaaccat catggtcaac      1800
     tgtaacccgg agaccgtctc cacggattat gatacctctg accgtctcta ctttgagccg      1860
     gttacgctgg aggatgtgct ggagatcgtc gccgtcgaac gtccgcaggg ggtgatcgta      1920
     cagtacggcg gccagacgcc gctaaagctg gcccgggcgc tggaggccgc aggcgtgccg      1980
     gttatcggca ccagtccgga cgccattgac cgcgccgagg atcgtgagcg cttccagaag      2040
     gcggtgaatc gcctggggct gaagcagccg gccaacgcta ccgtcacggc cattgagcag      2100
     gcggtggaga agggggccca gataggttat ccgctggtgg ttcgcccctc ttatgttctc      2160
     ggtggcaggg cgatggagat cgtctacgat gagagcgatc tgcggcgcta cttccagacg      2220
     gcggtcagcg tctccaacga tgcgccggtg ctgctggatc actttctgga cgatgcggtc      2280
     gaagtggacg tcgatgccat ctgtgacggc gagcgagtgt tgatcggtgg cattatggag      2340
     cacattgagc aggcgggggt acactccggt gactccgcct gttcgctgcc ggcctatacc      2400
     ctgagtgctg aaatccagga cgagctgcgc cgccaggcgg agaagctggc gatggagctg      2460
     tgcgtccgcg ggctgatgaa cgtgcagttt gcggtgaaag ataaccaggt atacctgatt      2520
     gaggtcaacc cgcgcgccgc gcgtaccgtt cccttcgtct ccaaggcgac cggcgtaccg      2580
     ttggctaagg tggccgcccg tgtgatggtg gggcagacgc tggcgcagca gggaatgaca      2640
     gaagaggtga tcccgcctta ttactccgtc aaagaggtgg tgctgccgtt tgccaagttc      2700
     cccggcgtcg acccgattct ggggccggag atgcgctcta ccggtgaagt gatgggggtg      2760
     ggccgtacct ttgccgaggc ctttgccaag gcgatgcttg gcagtctgtc gcaggtgaag      2820
     accccgggac gcgccctact gtcggttcgt gagggcgata agcaccgggt ggtggatctg      2880
     gcggccaagc tgctcaggca gggctttgag ctggatgcga cccacggcac cgcggtggtg      2940
     ctgggggaag cgggtattaa tccgcgtctg gtcaacaaag tgcatgaggg gcgtccacac      3000
     attcaggatc gcatcaagaa tggcgagtat acctatattg tgaacaccac cgccgggcgt      3060
     caggcgatcg aggattccaa gctgatccgc cgtagcgcgc tgcgctacaa ggtgcactac      3120
     gacaccacgc tgaacggcgg ttttgctacg gcgatggcgc tgaacgcgga tccgaccgaa      3180
     caggtgattt cagtacagga gatgcatgcc cgactgaagt aa                         3222
//

If you have problems or comments...

PBIL Back to PBIL home page