(data stored in ACNUC7421 zone)

EMBL: CP001600.PE641

CP001600.PE641       Location/Qualifiers
FT   CDS_pept        680123..680893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0691"
FT                   /product="Protein of unknown function (DUF1212)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67913"
FT                   /db_xref="GOA:C5B7N6"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N6"
FT                   /protein_id="ACR67913.1"
FT                   /translation="MESDRQREITRLCIHCALFLLQHGAESMLVEQLSTRLGLALGVDS
FT                   VESSISANAVVLTTIKDGRCLTSTRKNVDRGINMHVVTEVQHIVIMAEHRLLDMHDVRR
FT                   RLEHIRPLRYPRALVVLMVGLSCACFCKLNGGGWDGALVAFFASAVAMYARQLMTHRQL
FT                   NPLINFCITAFIATSVSGGLLQLSVFAGTSLIAMAASILLLVPGFPLINAVADMFKGHV
FT                   NTGLARWAMATLLTLATCLGVVMALSLWGLQGWA"
     gtggagtctg atcgccagcg ggagataacc cgcctgtgta ttcattgcgc ccttttcctg        60
     ctgcagcatg gtgccgagag catgttggtc gaacagcttt ctacccggct ggggttggcg       120
     ctgggcgtag acagtgtgga gagttctatt tctgccaacg cggtggtgtt gaccaccatc       180
     aaggatggcc gttgtctgac gtcgacgcgc aaaaatgtcg atcgcggcat caatatgcac       240
     gtggtgactg aggtgcagca tattgtgatt atggctgagc accgcctgct ggacatgcac       300
     gatgtgcgcc gacggttgga gcatatccgc ccgttgcgct atccgcgcgc gctggtggta       360
     ctgatggtcg gcctctcttg cgcctgtttc tgcaaactga atggcggcgg ctgggacggc       420
     gcgctggtgg ccttttttgc cagcgcggtg gccatgtatg cccggcaact aatgactcat       480
     cgacagctta atccgctgat taatttttgt attacggcct ttattgccac ctcggtctct       540
     ggcggcctgc tgcagctgag cgtatttgcc gggacatcgc tcattgccat ggcggccagt       600
     attctgctgc tggtgcctgg gtttcctctg atcaatgcgg tggcggatat gtttaaaggg       660
     catgtcaata ccgggctggc ccgctgggca atggcgacgc tgttgaccct ggccacctgt       720
     cttggcgtcg tgatggcgct atcgctgtgg ggactacagg gatgggcatg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page