(data stored in ACNUC7421 zone)

EMBL: CP001600.PE642

CP001600.PE642       Location/Qualifiers
FT   CDS_pept        680890..681357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0692"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0692"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67914"
FT                   /db_xref="GOA:C5B7N7"
FT                   /db_xref="InterPro:IPR020914"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7N7"
FT                   /protein_id="ACR67914.1"
FT                   /translation="MITLLLQLVQDMLLAAVPALGFAMVFNVPNRALRYCALLGAIGHG
FT                   SRLLLITLGLNIEWASLMAAILIGVIGIQWSRWLLAHPKVFTVAAVIPMFPGIYAYRAM
FT                   IAVVEISRSGYSEPLFASMVTNFLKASFIVGALSIGLSLPGIWLYRKRPGV"
     atgataacgc tgctgctgca gctggtgcag gatatgctgc tggccgctgt gccagcgctg        60
     gggtttgcca tggtgttcaa cgtgccaaac cgggccttac gttattgcgc actgctgggg       120
     gcaattgggc acggctcccg tctgttgttg ataacgttgg ggctgaatat tgagtgggcg       180
     tcgctgatgg cggcgatcct gatcggagtc atcggtattc agtggtcgcg ctggctgctg       240
     gcacacccga aggtgttcac cgttgcagcg gtgatcccga tgtttcccgg catctacgcc       300
     tatcgggcga tgatcgccgt ggttgagatc tcccgcagcg gctattccga gccgctgttc       360
     gccagcatgg tcaccaactt tctcaaggcc tcttttatcg taggggcgct ctccatcggt       420
     ctgtcattac cggggatatg gctgtatcgt aagcgccctg gagtctaa                    468
//

If you have problems or comments...

PBIL Back to PBIL home page