(data stored in ACNUC7421 zone)

EMBL: CP001600.PE645

CP001600.PE645       Location/Qualifiers
FT   CDS_pept        complement(683064..683441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0695"
FT                   /product="Protein of unknown function (DUF525)"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67917"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7P0"
FT                   /protein_id="ACR67917.1"
FT                   /translation="MIDAPRIIVQVQSVYAGSQSLPEEARFVFAYTVTLRNLGRFNVQL
FT                   LRRYWLITNGNGRQTEVQGEGVIGEQPLIQPNGEFQYTSGAIIETPCGTMEGHYEMVDH
FT                   QGHTFRIAIPVFRLAIPSLIN"
     atgatcgatg caccccgtat catcgttcag gtacagagtg tctatgctgg atcacagtcg        60
     ctgcctgaag aggcgcgctt cgtctttgcc tataccgtca ctctgcgtaa tctgggccgc       120
     tttaacgtac agctcctgcg ccgctactgg ctaataacca acggcaacgg ccgccagact       180
     gaagtccagg gcgaaggggt catcggcgaa cagccgctga tccagcccaa tggtgagttt       240
     cagtacacca gcggcgccat catcgaaacg ccctgcggta ccatggaggg gcactacgaa       300
     atggttgacc atcagggaca caccttccgt atcgccattc cggtcttccg cctggccatt       360
     cccagcctga ttaactga                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page