(data stored in ACNUC7421 zone)

EMBL: CP001600.PE649

CP001600.PE649       Location/Qualifiers
FT   CDS_pept        complement(686695..689082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0699"
FT                   /product="Organic solvent tolerance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0699"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67921"
FT                   /db_xref="GOA:C5B7P4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR007543"
FT                   /db_xref="InterPro:IPR020889"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P4"
FT                   /protein_id="ACR67921.1"
FT                   /translation="MTESLTPRMKKSIPTLIATLVWSALYSQHALASLAEQCLIGVPVY
FT                   DKPLVSGDINSLPVHITADQSEANYPNNALFHGNVDIQQGNSTLTADKVQLDQKAIQGQ
FT                   PNPLRTVTAIGNVHYADSQIRLQGPSAWSNLNNKDTNVWRGDYQFVGRQGRGDADLMKT
FT                   RDANRYTILDNGTFTSCLPGDNSWSIAGSEIIQDRKEQVAEIWNARFKIGPVPVFYSPY
FT                   LQFPTGNKRRSGFLIPSVNYSNGDGIEFTLPWYWNIAPQADATFTPHYMEKRGLQLQNE
FT                   FRYLSEFGMGQVEFDWLGNDRQFQQDRKNQGITGQELEDLKNRDRWLFYWRHSGVLDHW
FT                   RFGVDYTKVSDPYYFTDLSSSYGSSTSGYATQKFTLGYAETNWNATLSTTQFQVFANAG
FT                   DVNAYRTAPQLDLNYYKNDLGPFDFTLYGQAVKFTNDNVYLPGADRYHVEPVLSLPLSN
FT                   RWGSINTEAKLMATHYQQDVPSQGNLTQLKDNVNRVMPEFKIDGKMIFERDATLLSGYT
FT                   QTLEPRAQYLYIPYRDQSDIYSYDATLLQTDYTGLFRDRSYSGLDRIASANQVTTGLTT
FT                   RLYDDEQNERFNASIGQIYYFSPSRTGDETTTIDRHDNTGSLVWAGDSYLKLTDSWGLR
FT                   GGLQYDTRLNSVALGNAVMEYRKDAESVLQLSYRYASPEYITSMLPSYANNTIYNQGIS
FT                   QAGIIGSLPLAERWALVAGYYYDTKAKQSADAIAGLQYNTCCWSMGVTYERKINSWDSA
FT                   TQNSKYDNKFSLKFALRGMNQNYSLGSAEMLRSGILPYQRAF"
     atgacggaat ccctgacacc gcgtatgaaa aaaagtatac ccacgctgat agccaccctc        60
     gtctggtcag cgctttacag tcagcatgcg ctggcttccc tcgccgaaca gtgcctgatc       120
     ggcgttcccg tgtatgacaa accgttggtt tccggcgata tcaatagcct tccggtgcac       180
     attaccgcag atcagagcga agccaactac ccgaacaacg ccctgttcca cggcaacgtc       240
     gatattcagc agggcaatag caccctgacc gccgataagg ttcaactgga tcagaaagcg       300
     atccaggggc agcccaatcc gctgcgcacc gtgaccgcga taggcaatgt acactacgcg       360
     gacagtcaga tccggctgca gggccccagc gcctggtcca acctgaataa taaagatacc       420
     aacgtctggc gcggcgacta tcagtttgtc ggtcgccagg ggcgcggcga tgccgatctg       480
     atgaagaccc gcgacgctaa ccgctacacc atcctggata atgggacctt tacctcctgt       540
     ctgccgggtg acaacagctg gagtatcgcc ggctccgaga tcattcagga tcgtaaggag       600
     caggtggccg agatctggaa cgcccgcttt aagatcgggc cggttccggt cttctacagc       660
     ccctatctgc agtttccgac tggcaacaag cgccgctccg gctttctgat ccccagcgta       720
     aactactcca acggcgatgg gatagagttt accctgccct ggtactggaa catcgccccg       780
     caggctgacg cgacctttac tccgcactac atggaaaaac gcggtctgca gctgcaaaac       840
     gaattccgct atctgagtga atttggtatg ggtcaggtcg aatttgactg gctgggcaac       900
     gaccggcagt tccagcagga tcgtaaaaat caggggatca ccggacagga gctggaggat       960
     ctgaagaacc gcgatcgctg gctgttctac tggcgccact ctggcgtact cgaccactgg      1020
     cgcttcggcg tcgattatac caaggtcagc gatccctact acttcaccga cctgagctcc      1080
     tcctatggat ccagcaccag cggctacgcc acgcagaaat ttaccctggg ctatgccgag      1140
     accaactgga atgcgacgct ctcgaccacc cagttccagg tattcgccaa cgcgggggac      1200
     gtcaatgcct accgcaccgc accgcagctg gatctgaact actacaaaaa cgatctgggc      1260
     ccgttcgact tcaccctgta cggtcaggcg gtcaagttca ccaacgacaa cgtctacctg      1320
     cccggggccg accgctacca cgtcgagccg gtcctgtcgc tgccgctgtc caaccgctgg      1380
     gggagcatca atacagaagc gaagctgatg gcgacccact atcagcagga tgtccccagc      1440
     caaggtaacc tgacgcagct gaaggacaac gtcaaccgcg tgatgccgga gtttaagatc      1500
     gacggtaaga tgatctttga gcgcgacgcc accctgctga gcggctatac ccagacgctg      1560
     gagccgcgcg cccagtatct gtatattccg taccgcgacc agagcgacat ttactcttac      1620
     gacgccaccc tgctgcagac cgactatacc ggcctgttcc gcgaccgcag ctacagcggt      1680
     ctggaccgta tcgcctcggc caatcaggtc accaccggcc tgacgacccg cctgtacgat      1740
     gatgagcaga acgaacgctt caacgcctct atcgggcaga tttactactt ttcaccgtcg      1800
     cgtaccggcg atgaaaccac cactatcgat cgccacgata acaccggcag cctggtatgg      1860
     gccggagaca gctaccttaa gctgaccgat agctggggtc tgcgcggcgg tctgcagtat      1920
     gatacccgac tgaacagcgt ggcactgggt aacgcggtga tggagtatcg taaagacgcc      1980
     gagagcgtac tgcagctcag ctatcgctac gccagcccgg agtacattac ctccatgctg      2040
     ccaagctacg ccaataatac catctacaac cagggcatca gccaggctgg gatcatcggc      2100
     agcctgccgt tggccgagcg ctgggcgctg gtcgccggtt actactatga taccaaggcg      2160
     aagcagtccg ccgatgccat cgccggcctg cagtacaata cctgctgctg gtcgatgggc      2220
     gtcacctatg agcgcaagat caacagctgg gacagcgcga cccagaacag caagtatgac      2280
     aacaagttct cgctcaagtt tgccctgcgc gggatgaacc agaactacag cctgggctct      2340
     gcagagatgc tacgctccgg cattctgcct tatcaacgcg ccttctaa                   2388
//

If you have problems or comments...

PBIL Back to PBIL home page