(data stored in ACNUC7421 zone)

EMBL: CP001600.PE65

CP001600.PE65        Location/Qualifiers
FT   CDS_pept        complement(59394..60548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0068"
FT                   /product="glycosyl transferase, group 1 family protein"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67328"
FT                   /db_xref="GOA:C5BB93"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB93"
FT                   /protein_id="ACR67328.1"
FT                   /translation="MTEKSIVHLVNLRDFGGVERLILDYVINGKEHNWVIINTANSLSE
FT                   KLNDHANSIIFCNRVIQSSPIQIPSFIRKKALWNKIKKINPSHVVIWNQIIPLEYKPES
FT                   IKAIYYDHGAVWEIDKNKKTIAFFQKIDGCICVSQASKKMLENKFKHHCDISVILNRTN
FT                   IKSRDSIADDKKKTFTIGCAARLSPLKALGLIPLIAEETALQGFNFNFIIAGTGEEESA
FT                   LASLIEKKNLNKSVKTIGFLNNLNDFYKHLDIYISTSAHETCSLSCIEAMSFGIPIISA
FT                   NIDGQPEIISNDHTGFCITPTMSMEDYCKKTGMSLPFKKNIYYPENDQIAPPRLLNPKD
FT                   AANKIIEIYLHGVDDYKKNSIHRAKELFDDKNFEESLIKTIRSF"
     atgacagaaa aaagtattgt tcacttggtt aatcttcgcg atttcggtgg cgttgaacgc        60
     cttattttag actatgtaat taatggcaag gagcataatt gggttattat aaacacggcc       120
     aattcactca gtgagaaatt gaacgatcat gccaattcaa ttattttctg caatcgggta       180
     attcagtcat cacctatcca aatcccatca tttataagaa aaaaagcgct ctggaacaaa       240
     attaaaaaaa taaacccaag ccatgttgtc atctggaatc aaattatccc acttgaatac       300
     aaacctgaat caatcaaagc gatatattat gaccatggcg ctgtatggga gattgataaa       360
     aacaaaaaaa ccattgcttt ttttcaaaaa atagatggct gcatttgtgt atcacaagct       420
     tccaagaaaa tgttggaaaa taaattcaaa catcactgtg acatatcagt aatattaaac       480
     agaactaata ttaaatcacg agatagcatc gctgacgata agaaaaaaac ctttactatc       540
     ggctgtgcag cacggctctc tccattaaaa gcgttgggat taatccccct gattgcagag       600
     gagacagccc tacaaggatt taacttcaat tttattattg ccggaacagg tgaagaggaa       660
     tctgcattag cgagtttaat agaaaaaaag aatctaaaca aatcagtaaa aacaattggc       720
     tttctcaata accttaacga cttttataaa catcttgata tttacataag tacctctgca       780
     catgaaacat gcagtctgtc ctgcattgaa gcaatgtcat ttggcatacc aattatttcg       840
     gcaaatattg atggtcagcc tgaaataatt agtaatgacc atactggctt ctgtattaca       900
     ccgacgatga gcatggagga ctattgcaaa aaaacaggaa tgtccctacc atttaaaaag       960
     aatatctact atccagaaaa tgaccaaatt gctccgcctc gtttattaaa ccccaaggat      1020
     gcagcaaata aaataattga aatttatctt catggcgtgg atgattacaa aaaaaactcc      1080
     atacatcgag ccaaagaact ctttgatgat aaaaactttg aggaaagcct cattaaaaca      1140
     attaggagtt tttaa                                                       1155
//

If you have problems or comments...

PBIL Back to PBIL home page