(data stored in ACNUC7421 zone)

EMBL: CP001600.PE650

CP001600.PE650       Location/Qualifiers
FT   CDS_pept        689240..690061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0700"
FT                   /product="DnaJ domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67922"
FT                   /db_xref="GOA:C5B7P5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P5"
FT                   /protein_id="ACR67922.1"
FT                   /translation="MRYWGKFVGVLLGLMSGIGFWGVVLGFLIGHMFDKSRAIKRQGYF
FT                   ANQQQRQGLFFRTTFQVMGHLTKSKGRVTEADIQVASMFMDRLNLHGDARLMAQQAFRE
FT                   GKEPGYPLRERLRELRSVCFGRIDLIRIFLEIQLQAAFADGQLHPNERAVLYVIAEELG
FT                   FSHAQFDQFLGMMEGGRQFGGGYHQAGGQQGGFYTPPQGPTLEDACKVLGVASSADATT
FT                   IKRAYRKLMSEHHPDKLVAKGLPPEMMELAKQKAQEIQAAYDLIKKEKGFK"
     atgcgctatt ggggtaaatt cgtaggggtg ttgctggggc tgatgtccgg gatcggtttc        60
     tggggtgttg ttctgggttt tttgattggt catatgtttg ataagtcgcg cgcgattaag       120
     cgtcagggct attttgccaa tcagcagcag cgccaggggc tgtttttccg caccaccttt       180
     caggttatgg gacatctgac aaagtcgaag gggcgggtga cagaggccga tattcaggtt       240
     gcctccatgt ttatggatcg cctgaatctg catggcgatg ccaggctgat ggcgcagcag       300
     gctttccgcg agggcaagga gcccggctac ccgctgcggg agcgcctgcg cgaactgcgc       360
     agcgtctgct ttggccgtat cgatctgatc cgtatctttt tggagatcca gctgcaggcg       420
     gcgttcgccg atgggcagct gcacccgaat gagcgggcgg tgctgtatgt gatcgccgaa       480
     gagctgggtt tttcacatgc gcagttcgat cagtttctgg gcatgatgga gggcgggcgc       540
     cagtttggcg gcggctacca tcaggcggga ggacagcagg ggggattcta tacgccgccc       600
     caggggccga cgctggagga tgcctgtaag gtgctggggg tggcgtcgag cgccgatgcg       660
     accacgatca agcgtgcgta tcgtaagctg atgagcgagc atcaccccga taagctggtg       720
     gctaaagggc tgccgccgga gatgatggag ctggccaagc agaaggcgca ggagatccag       780
     gctgcgtacg atctgattaa gaaagaaaag ggattcaagt ag                          822
//

If you have problems or comments...

PBIL Back to PBIL home page