(data stored in ACNUC7421 zone)

EMBL: CP001600.PE652

CP001600.PE652       Location/Qualifiers
FT   CDS_pept        complement(690845..693697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0702"
FT                   /product="Type III restriction enzyme, res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0702"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67924"
FT                   /db_xref="GOA:C5B7P7"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P7"
FT                   /protein_id="ACR67924.1"
FT                   /translation="MGTVVALDARMVTLLFPATGENRLYARNDSPITRVMFNPGDTITT
FT                   HEGWQLCVEEVQEHEGLLTYIGNRCDNGENSVAVREVLLDSRLTFSKPQDRLFAGQIDR
FT                   MDRFALRYRARKYQSEQFRLPCSGLRGMRASLIPHQLHIARDVGQRHAPRVLLADEVGL
FT                   GKTIEAGMIIHQQLLSGRAERVLIVVPETLQHQWLVEMLRRFNLRVALFDDERYAEAAQ
FT                   DSSNPFETEQLVICSLDFVRRSRQRLEQLADASWDLLVVDEAHHLAWSEQAPSREYQVI
FT                   EQLAEQIPGVLLLTATPEQLGQESHFARLRLLDPNRFHDYAQFVAEQLRYRPVADAVTL
FT                   LLNDGHLQQDELNMLCEMVAEQDIEPLLKAANTDGEDSQQARAELVRMLMDRHGTSRVL
FT                   FRNTRQGVKGFPQRTLHQITLPLPAQYQTAIKVSGIMGSKKSVEAQANDMLYPERIYQE
FT                   FEGENATWWNFDPRAEWLLDFLLTQRDEKVLVICAQAATAIHLEQLLREREGIRAAVFH
FT                   QGMSLIERDRAAAYFASQEEGAQVLLCSEIGSEGRNFQFANHLVMFDLPFNPDLLEQRI
FT                   GRLDRIGQARDIQIYVPCLEGTAQSVLIRWYHQGLDAFEHTCPTGRTIYDRYYETLLAF
FT                   LAKPAQLDGFDDFIKTCRTDHDTLKIQLEKGRDRLLEMHSNGGEAAQALAGSIAAQDND
FT                   VNLVNFALNLFDIVGINQEDRSDSLIVLTPSDHMLVPDFPGLPQDGCTVTFDREQALSR
FT                   EDAQFISWEHPLMRNGLDLILSGDTGSSAVSLLKNKALPVGTLLLEAVYVVEAQAPKQL
FT                   QLTRFLPPTPVRMLLDAKGNDLAAQVEFESFNRQLNAVNRHTASKLVNAVQPNVHAMLQ
FT                   SGEALIADQAQALIDAAKREADEALSAELARLESLRAVNPNIRDDELETLEFTRRKVLE
FT                   TLDQAGWRLDALRLIVVSHQ"
     ttgggtaccg tggtggcgct ggatgcgcgc atggtgacac tgctgtttcc cgcgaccggc        60
     gaaaaccgtc tgtatgcccg caatgactcc cccatcaccc gcgtgatgtt taacccggga       120
     gacaccatta ccacccacga agggtggcag ctgtgcgttg aagaggtaca ggagcatgag       180
     ggtctgctga cctatatcgg caaccgctgc gacaacggtg aaaactcggt ggcggtgcgc       240
     gaggtgctgc tcgacagccg tctgaccttc agtaaaccgc aggatcgcct gtttgccggc       300
     cagatcgacc gtatggaccg tttcgccctg cgctatcgcg cgcgtaaata ccagagcgag       360
     cagttccgtc tgccctgcag cggcctgcgc ggcatgcgcg ccagcctgat cccacaccag       420
     ctgcatatcg cccgcgatgt gggccaacgc cacgcgccac gcgtcctgct ggcggacgaa       480
     gtgggtctgg gtaagaccat cgaagccggc atgattattc atcagcaact gctctccggc       540
     cgcgccgaac gcgtactgat cgtggtaccg gaaaccctgc agcaccagtg gctggtcgaa       600
     atgctgcgcc gctttaacct gcgcgtggca ttgttcgacg atgagcgcta tgcggaggcc       660
     gcccaggaca gcagcaaccc gtttgaaacc gaacagctgg ttatctgctc cctcgacttc       720
     gtccgccgca gcaggcagcg tctggagcaa ctggccgacg ccagctggga tctgctggtg       780
     gtcgatgaag ctcaccatct ggcctggagc gaacaggcgc ccagccgtga ataccaggtc       840
     atcgagcagc tggccgaaca gatccccggg gtgctgctgc tgactgccac ccccgaacag       900
     ctgggtcagg agagccactt tgcccgcctg cgcctgctgg atcccaaccg ttttcacgac       960
     tacgcacagt tcgtcgccga gcagctgcgc taccgcccgg tggcggacgc cgttaccctg      1020
     ctgttgaacg acggtcatct gcagcaggat gagctcaata tgctctgcga gatggtcgcc      1080
     gaacaggata tcgaaccgct gctgaaagcg gccaacaccg acggcgagga cagccagcag      1140
     gcccgcgctg aactggtgcg tatgctgatg gatcgccacg gcaccagccg cgtgctgttc      1200
     cgcaataccc gtcagggggt taaaggcttt ccgcagcgta ccctgcatca gatcaccctg      1260
     ccgctgccgg cgcagtatca gacagcgatt aaagtctccg gcattatggg cagcaagaag      1320
     agcgtcgagg cacaggccaa cgatatgctc tatccggagc ggatctacca ggaattcgaa      1380
     ggggaaaacg ccacctggtg gaactttgac ccgcgcgccg aatggctgct cgacttcctg      1440
     ctgacccagc gtgacgagaa ggtgctggtt atctgtgccc aggcagccac tgccatccat      1500
     ctggagcagc tgctacgcga gcgtgaaggg atccgcgccg ccgtcttcca tcaggggatg      1560
     tcgctgattg agcgcgaccg cgccgcggcc tactttgcct cgcaggaaga gggtgctcag      1620
     gtactgctgt gctcggagat cggctccgag gggcgtaact tccagtttgc caaccacctg      1680
     gtgatgttcg atctgccgtt taacccggat ctgctggagc agcgcattgg ccgcctggac      1740
     cgcatcggcc aggcgcgcga cattcagatc tacgttccct gtctggaggg aaccgcacaa      1800
     tccgtactga tccgctggta tcatcagggg ttggacgcct ttgagcacac ctgtcccacc      1860
     ggccggacca tctatgaccg ctactatgaa accctgctgg cgttcctggc caaaccggct      1920
     cagctggatg gctttgacga ctttatcaaa acctgccgca ccgaccacga tacgctgaaa      1980
     atccagctgg agaagggacg cgatcgcctg ctggagatgc actccaacgg cggtgaggcg      2040
     gctcaggcgc tggccgggag catcgctgcg caggataacg acgtcaatct ggtcaacttt      2100
     gcgctgaacc tgttcgatat cgtcggtata aatcaggagg atcgcagcga cagcctgatc      2160
     gtgctgaccc cgtcggatca catgctggtg cctgacttcc cggggctgcc gcaggatggc      2220
     tgcaccgtca ccttcgatcg cgaacaggcg ctgtcgcgcg aagatgccca gttcatcagc      2280
     tgggagcacc cgctgatgcg caacggcctg gacctgatcc tctccggcga taccggctcc      2340
     agcgcggttt ctctgctgaa gaacaaggcg ctgccggtcg gtacgctgct gctggaggcg      2400
     gtgtacgtgg tcgaggccca ggcaccgaag cagctacagc tgacccgctt cctgccgccg      2460
     acgccggtgc gtatgctgct ggacgccaag gggaacgacc tggcagctca ggtggagttc      2520
     gaaagcttca accgccagct caacgccgtc aaccgccata ccgccagcaa gctggtcaac      2580
     gcggtacagc ccaacgtaca cgccatgctg cagtctggag aggcgctgat agcagaccag      2640
     gcgcaggcgc tgatcgacgc tgccaagcgt gaggccgatg aagcgctgag cgccgagctg      2700
     gcacgtctgg agtcgctcag ggcggtaaac cccaatatcc gtgacgatga gctggagacc      2760
     ctggagttca cccgccgtaa ggtcttggag acgctggacc aggccggctg gcgtctggat      2820
     gccctgcgcc tcattgtggt gtcgcaccag taa                                   2853
//

If you have problems or comments...

PBIL Back to PBIL home page