(data stored in ACNUC7421 zone)

EMBL: CP001600.PE653

CP001600.PE653       Location/Qualifiers
FT   CDS_pept        complement(694015..696354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0703"
FT                   /product="DNA polymerase family B protein"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0703"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67925"
FT                   /db_xref="GOA:C5B7P8"
FT                   /db_xref="InterPro:IPR006134"
FT                   /db_xref="InterPro:IPR006172"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR017964"
FT                   /db_xref="InterPro:IPR023211"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR042087"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7P8"
FT                   /protein_id="ACR67925.1"
FT                   /translation="MNTPQPGFILTRHWRDTPQGVCVTLWLATERGPRCITLPPEPAVA
FT                   FMNAAQRDAAQHLLRGFPDVELRPVTLRDFHHQPVLALYCRGYRQLQQIERRLKAQGIP
FT                   LLEADIRPADRYLMERFINAPLWFCSDAGGAEARIKPHPHYRPTLRTVSLDIETSPRGE
FT                   LYSIGLHGCDQRIVYMLGPANGDAQALDFTLEYVASRAALLDALNRWMACHDPDAIIGW
FT                   NLVQFDLQILQRHAEREGVPLLLGRAATPLEWREHGFRAGHFFASAPGRLIIDGIEALK
FT                   SAFWHFPSYSLDSVAQTLLGEGKALDDPYRRMAEITRHFRQDKPALAHYNLRDCELVTR
FT                   IFAHTALMPFLLERASVTGLAPDRSGGSVAAFYHLYLPRMHRLGYVAPSLGEVAPQASP
FT                   GGFVMASRPGLYDSVLVLDYKSLYPAIIRSFLIDPVGLASGGEQPDDAHSVPGFLGARF
FT                   SRTRHALPEIVRQLWQGREAAKRLDNAPLAQALKILMNAFYGVLGTSACRFFDPRLASS
FT                   ITLRGHEIMRQTRSLIEALGYTVIYGDTDSTFVWLGKPHDEAQAEAIGQTLAGRVNAWW
FT                   REHLSQQYGLESALELEYECHYRRFLMPTLRGADLGSKKRYAGLCGERLVFKGLETVRS
FT                   DWTPLAQRFQQELYRRVFLGQSYRDVIRRYADGLLAGAFDDQLIYRKRLRRPLAEYQRN
FT                   VPPHVRAARLADEYNHQLERPLQYQNGGWISYIITRSGPQPLECIDAPADYQHYLERQL
FT                   QPVADAILPFLGDDFETLLTGQLGLF"
     gtgaatacgc cgcaacctgg ctttatcctc acccgtcact ggcgagatac gccacagggc        60
     gtctgcgtta cgctatggct ggccacggag cgcggccccc gctgcattac cctgccgccg       120
     gagccggcgg tggcctttat gaacgccgca cagcgtgatg ccgcgcagca tctcctgcgc       180
     ggttttcccg acgtcgagct gcgaccggtg acgctgcgcg atttccacca tcagccggta       240
     ctggcgctat actgccgtgg ctaccgtcag cttcagcaga ttgaaaggcg cctcaaggcg       300
     caggggatcc cgctgctgga ggctgatatc cggcccgcgg accgctacct gatggaacgc       360
     tttatcaatg cgccgctgtg gttctgcagc gatgcagggg gcgcagaggc ccggattaaa       420
     ccccaccctc actaccgccc gacgctgcgt acggtgtcgc tggacattga aaccagcccc       480
     cggggagagc tctattcgat cggcctgcat ggctgcgacc aacgcatcgt ctatatgctg       540
     ggccccgcca acggcgacgc gcaggcgctg gacttcaccc tggagtacgt cgccagccgc       600
     gccgcgctgc tcgacgccct caaccgctgg atggcgtgcc acgatcccga tgccatcatc       660
     ggctggaatc tggtgcagtt cgatctgcag atcctgcagc gccacgccga gcgcgagggc       720
     gtccctctgt tgctggggcg cgcggcgacg ccgctggagt ggcgagagca cggctttcgc       780
     gccggccatt tttttgccag cgcccccggc aggttgatca tcgacggtat cgaggcgctg       840
     aaaagcgcct tctggcactt tccctcctac agcctggaca gcgtggcgca gaccctgctg       900
     ggcgaaggca aggcgctgga tgacccctac cggcgcatgg cggagatcac ccggcacttt       960
     cgtcaggaca aaccggcgct ggcacactat aacctcaggg attgcgaact ggtgacgcgc      1020
     atcttcgcac acaccgccct aatgccgttc ctgctggagc gggccagcgt taccgggctg      1080
     gcccccgatc gcagcggcgg ctccgtggcc gcattctacc acctgtatct gccgcgcatg      1140
     caccggctgg ggtatgtcgc cccctccctg ggcgaggtgg cgccacaggc cagccccggc      1200
     ggctttgtca tggcctcacg cccggggctg tatgactccg tgctggtatt agactacaag      1260
     agcctgtatc cggcgatcat ccgctccttt ctgatcgacc ccgtcggact ggccagcggc      1320
     ggagagcagc ctgatgacgc ccacagcgtg cccggctttc tcggtgcccg cttctcacgc      1380
     acccgccacg ccctgccgga gattgtgcgc cagctgtggc agggacgcga ggcggccaaa      1440
     cgcctggaca atgcgccgct ggcgcaggcc ctgaagatcc tgatgaacgc cttctacggc      1500
     gtgctgggca ccagcgcctg tcgcttcttc gatccccgcc tggcctcatc cattaccctg      1560
     cgcggccatg agatcatgcg ccagacgcgc agcctgatcg aagcactggg ctatacggtg      1620
     atctatggcg acaccgactc cacctttgtc tggctgggta agccgcacga tgaggcccag      1680
     gccgaagcta ttggccagac gctggctggg cgggtcaacg cctggtggcg cgagcacctg      1740
     tcacagcaat atggtctaga gagcgcgctg gagctggagt atgagtgcca ctatcgccgt      1800
     tttctgatgc ccaccctgcg cggcgccgat ctcggcagca aaaagcgcta tgccgggctg      1860
     tgcggcgagc gacttgtgtt taaagggctg gagacggtgc gcagcgactg gacgccgctg      1920
     gcgcagcggt ttcaacagga actctatcgc cgggtgtttc tcggccagag ctaccgcgac      1980
     gtgattcgcc gctacgccga cggcctgctg gcgggagcat ttgacgacca actgatctac      2040
     cgcaagcgcc tgcggcgccc actggccgag tatcagcgca acgttccacc gcacgtccgc      2100
     gccgcgcgcc tggccgatga atacaaccac cagctggaac gccctctgca gtatcagaac      2160
     ggcggttgga taagctatat catcacccgc agcggcccac agccgctgga gtgtatcgat      2220
     gcgccagcgg actatcagca ctatctggaa cgccagctgc agccggtcgc cgacgctatt      2280
     ctgccctttc tcggcgatga ctttgagacc ctgctaaccg gtcaactggg gctgttttaa      2340
//

If you have problems or comments...

PBIL Back to PBIL home page