(data stored in ACNUC7421 zone)

EMBL: CP001600.PE656

CP001600.PE656       Location/Qualifiers
FT   CDS_pept        complement(698789..699784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0706"
FT                   /product="thiamin/thiamine pyrophosphate ABC transporter,
FT                   thiamin/thiamine pyrophospate-binding protein, putative"
FT                   /note="thiamin/thiamin pyrophosphate ABC transporter,
FT                   thiamin/thiamin pyrophospate-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0706"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67928"
FT                   /db_xref="GOA:C5B7Q1"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR005967"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q1"
FT                   /protein_id="ACR67928.1"
FT                   /translation="MLKKLFSILALLTVSLLAQAAGKPVLTVYTYDSFAADWGPGPKIK
FT                   QAFEQSCHCELRLVPLEDGVAILNRLRMEGKNSPADLVLGLDNNLLTAARHSGLFSPSQ
FT                   IDTRGQQIPGGWHDATFVPYDYGYFAFVYDRQQVKNPPSSLKQLVEGPEKWRVIYQDPR
FT                   TSTPGLGLLLWMQKVYGDQAPAAWQKLAQKTVTVTKGWSEAYGLFLKGEADMVLSYTTS
FT                   PAYHIIEEHNDRYATAMFDEGHYLQVEVAGILKHSRQPALAHQFMQFITTPAFQNAIPT
FT                   GNWMYPATAVPLPPAFAALPRPQKTLSFTADDVAQHRAEWIRAWQSALSR"
     gtgttaaaaa aactgttttc cattctggcc ctactgacgg tctcgctgct ggcgcaggcg        60
     gccggcaagc ctgtcctgac cgtctacacc tatgactctt tcgccgccga ctggggaccc       120
     gggcccaaga tcaagcaggc cttcgaacaa tcctgccact gtgagctcag gctggtcccg       180
     ctggaggacg gcgtcgctat ccttaaccgc ctgcggatgg aggggaaaaa cagcccggcc       240
     gacctcgtgc tggggctgga taacaacctg ctgaccgccg cccggcacag cgggctattc       300
     agccccagcc agatagacac ccgcggacag cagatccccg gcggctggca cgacgccacc       360
     tttgtcccct acgactacgg ctatttcgcc tttgtctatg accgccagca ggttaaaaat       420
     ccgccctcca gcctgaaaca gctggttgag ggcccggaaa agtggcgcgt catctatcag       480
     gacccgcgca ccagcacccc ggggcttggc ctgctgctat ggatgcagaa ggtgtatggc       540
     gatcaggcgc cggccgcctg gcagaagctg gcgcaaaaaa ccgtcaccgt caccaaaggg       600
     tggagcgagg cctacggcct attcctgaag ggagaggcgg atatggtgct cagctatacc       660
     acctcgccgg cctaccacat catagaagag cataatgatc gttatgccac cgcgatgttt       720
     gacgaaggtc actatctgca ggtcgaagtg gccgggatac taaaacacag ccgtcagcca       780
     gcgctggcgc accagtttat gcagttcatt accaccccgg cgttccagaa tgccatcccg       840
     accggcaact ggatgtatcc ggcgacagcg gtaccgctgc cgccggcctt cgccgccctg       900
     cccaggccgc agaagacact cagctttacc gccgacgacg tcgcacagca ccgggctgag       960
     tggatccgcg catggcaaag cgccctgagc cgctga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page