(data stored in ACNUC7421 zone)

EMBL: CP001600.PE66

CP001600.PE66        Location/Qualifiers
FT   CDS_pept        complement(60550..61683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0069"
FT                   /product="O-antigen ligase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67329"
FT                   /db_xref="GOA:C5BB94"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:C5BB94"
FT                   /protein_id="ACR67329.1"
FT                   /translation="MKTNFINKLPIYISALFCVFVSLLSISDDNNLVSNIYYVSFALFI
FT                   VWCVCERKNIFNKTSLLLGVFLLFSAISTYWSDHSKDTSRYIQHAIYIFIFSSMIYELR
FT                   STLFFKNILFKSYVATCSIFVVVNGFIFYSKYSLYDRFYPILGPSNTIDYAGILCLAII
FT                   FCCYLYQHEKNKSPYIIAGIVLLAGVILSQSRTPIIALAISLMAIFIKRKRSAIISLVS
FT                   ILAIILLVHTVYPSIFTRDAVDGAPTPRIFTWLYTIQQVSEHHPWLGFGYSDTFAHYFK
FT                   PRNFTYNNAHSVFMSMLYYSGIIGVILFFSYILNIFSVAIKIFNKNRYPIAFILISLIF
FT                   SSTQGYIYIYHPREIWLVLWLPLFLAIPMSKRSSEQL"
     atgaaaacta atttcataaa taagctacct atatatattt cagcattatt ttgcgtattt        60
     gtttcactgc tatcgattag cgatgataat aatttagtta gcaatattta ttatgtttcg       120
     tttgcattat ttatcgtatg gtgcgtgtgc gaaagaaaaa acatattcaa caaaacaagt       180
     ttattacttg gtgtcttcct tctattcagc gccatatcaa catattggtc tgatcacagt       240
     aaagatacat ctcgctatat acagcatgcg atatatattt tcatcttctc atctatgatt       300
     tatgagctga gaagcacact tttttttaaa aatattctat ttaaatccta tgtcgcgaca       360
     tgctctatat ttgttgtagt aaatggattt attttttatt caaagtatag cttatatgat       420
     agattctatc cgatcctcgg tccctctaac acgatagatt atgcaggaat actatgtttg       480
     gcaataatat tttgctgcta cctctatcag catgaaaaga ataaatcccc atatattatt       540
     gctggcatag ttctattagc tggcgtgata ttaagccaga gcagaacccc aataattgct       600
     ttagccatat cgctcatggc catttttata aaaagaaaga gatctgctat aatatcattg       660
     gtgtccatac tggcaatcat attactggtg catacggtct acccaagcat ttttacccgt       720
     gatgctgtcg atggcgcacc tacgccaaga atttttactt ggctatatac tatccaacaa       780
     gtaagcgaac atcacccatg gcttggcttt ggctatagtg atacatttgc tcattatttc       840
     aaacctcgga atttcactta caataatgcc cacagcgtct tcatgagtat gctctactat       900
     tctggcatca ttggggttat cctgtttttt tcttatattt taaatatctt ctctgtagca       960
     ataaaaatct tcaataaaaa cagatatcct atcgcattta ttttaatttc gctaatattt      1020
     tcatcaaccc aaggatatat atatatttat catccgcgcg aaatatggct agttttatgg      1080
     ctaccgctat tcttagctat cccaatgagc aagagatcct cggagcaatt ataa            1134
//

If you have problems or comments...

PBIL Back to PBIL home page