(data stored in ACNUC7421 zone)

EMBL: CP001600.PE661

CP001600.PE661       Location/Qualifiers
FT   CDS_pept        complement(704345..705313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0712"
FT                   /product="ABC-type multidrug transport family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0712"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67933"
FT                   /db_xref="GOA:C5B7Q6"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q6"
FT                   /protein_id="ACR67933.1"
FT                   /translation="MFHWFERLTEPFPSQDPQKPPATLFGFCRHYTRGFERPLCAMALL
FT                   SAAVAVCEVILLRYLGELVDLLSHAERATFWADQRPSLIGMTILVLVVMPLLAWLHSNL
FT                   LHQSILGNYPMAVRWQVHRYLLGQSIAFFQRDFAGRVAAKVMQSAQSVREVVMKMVDLL
FT                   IYILVYLLSVLVMIASVDALLLIPLLLWLATYTLIQIHLLPRLRRIASEQANAQSMMSG
FT                   TIVDTYTHITTVKLFSHDQRESDYARHAMQRYLATVYRQMRTLTGLLFSVDVINYLLLF
FT                   SLAALSIALWQQQARYRHRHQSCPASTGHVQVDYVGGARTV"
     atgtttcatt ggttcgaacg actgacggag ccgtttccgt cacaggatcc ccaaaagccg        60
     ccggcgacgc tgttcggttt ctgccgccac tacacccgcg gttttgagcg cccgctctgc       120
     gccatggcgc tgctcagcgc cgccgtcgcc gtctgcgagg tcatactgtt acgctacctg       180
     ggcgagctgg tcgacctgct gagccacgcc gagcgcgcca ccttctgggc cgatcaacgc       240
     cccagcctga taggcatgac gattctggtg ctggtggtca tgcccttact ggcctggctg       300
     cactcaaacc tgctgcacca aagtattctg ggaaactacc ccatggccgt ccgttggcag       360
     gtgcatcgct atctcctcgg tcagagcatc gcgttttttc agcgtgattt tgccgggcgg       420
     gtggcggcaa aggtgatgca aagtgcccaa tcggtgcgcg aagtggtgat gaaaatggtc       480
     gatctgctga tctatattct ggtgtatctg ctctcggtgc tggtcatgat cgccagcgtc       540
     gatgcactac tgctgatccc cttactgctg tggctggcga cctataccct gattcagatc       600
     catctcctgc cgcgcctacg gcgcatcgcc agtgagcagg ccaacgcgca gtccatgatg       660
     agcggcacca tcgtggacac ctatacccac atcaccaccg tcaaactgtt ttcccatgat       720
     cagcgcgaaa gcgactatgc ccgacacgcc atgcagcgct atctggccac ggtataccgt       780
     cagatgcgca ccctgaccgg gctgctgttc agcgtggatg tcatcaacta tctgctgctg       840
     ttttccctgg cggcactgtc tatcgccctg tggcagcagc aggcgcgtta tcgccatcgg       900
     catcagtctt gccctgcgtc tacagggcat gtccaagtgg attatgtggg aggtgcgcgc       960
     actgtttga                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page