(data stored in ACNUC7421 zone)

EMBL: CP001600.PE662

CP001600.PE662       Location/Qualifiers
FT   CDS_pept        705425..706198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0713"
FT                   /product="ABC transporter, ATP-binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0713"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67934"
FT                   /db_xref="GOA:C5B7Q7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q7"
FT                   /protein_id="ACR67934.1"
FT                   /translation="MFSLTNLEVVRGGREVLVIEQLTIPTDRLTVILGHNGSGKSTLVS
FT                   LLAGQLRPDGGQIALDGQALSSLSAGALARRVAFLPQKLPTSAGLTVRELVRLGRFPWR
FT                   GMLGRWRREDRQLIDAAMAETGVTPFAETLVDTLSGGERQRAWVAMLLAQASPLLILDE
FT                   PTSALDIQHQYQLMALLSALPRGVLVILHDLNLALRYADHVIALKQGRVAFAGPAAALA
FT                   DERRLSELYQTPIRLTDHPHPAPGAPPHKVAIVCA"
     atgttttcgc taaccaacct agaggttgtg cgcgggggac gcgaggtcct ggttatcgaa        60
     cagttgacga tcccaacgga tcgtctgacg gtaattctgg gacataacgg gtccggtaaa       120
     tcgacgctgg tcagcctgct ggccggccag ctgcgccccg acggcggcca gatcgctctg       180
     gatgggcagg cgctgtcatc cctctccgcc ggtgcactgg cgcggcgggt ggccttttta       240
     ccgcagaagc tgcccaccag cgccgggctg accgtgaggg agctggtgcg cctggggcgt       300
     tttccatggc gtggcatgct ggggcgctgg cgccgtgaag atcggcagct catcgacgcg       360
     gcgatggctg agaccggggt gacccccttt gccgaaacgc tggtggatac gctgtccggc       420
     ggggaacgcc agcgggcgtg ggtcgccatg ctgctggcgc aggcctcgcc gctactgatc       480
     cttgatgaac cgacctcggc gctggatatc cagcatcagt accaactcat ggcgctgcta       540
     tcggcgctgc cgcgcggtgt cttggtcatt ctgcacgacc tgaatctggc gctgcgctat       600
     gccgatcacg tgattgccct gaagcagggg cgcgtggcct tcgctggccc ggcggcggcg       660
     ttggccgacg agcggcgcct gtccgagctg taccaaaccc cgatccgcct gacggatcac       720
     ccgcatcctg cccccggggc gccgcctcat aaagttgcta tcgtatgtgc ttga             774
//

If you have problems or comments...

PBIL Back to PBIL home page