(data stored in ACNUC7421 zone)

EMBL: CP001600.PE663

CP001600.PE663       Location/Qualifiers
FT   CDS_pept        706189..707121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0714"
FT                   /product="iron periplasmic binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0714"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67935"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q8"
FT                   /protein_id="ACR67935.1"
FT                   /translation="MCLIFNFIFRFFAPLALLFSLFSPSAQALTVSDSRGTHQLPAVPT
FT                   RAVVLDWDLLEQTIELGVTPLAATDLDSYREWVAQPPIPAQTQSVGSREEPNLERIAAL
FT                   KPDVILASEMQQALLPRLMQIAPVLYYTNFSAADDHAAVAIAQFRQLAQAFGREAIAEQ
FT                   KLAAMQARFQHLSRALRAAFQGQLPAVTVMRFASTTSTYLYTTNSMPVYVLRQLGISPA
FT                   LTPPPARWGIVRQPIAGLQRVGQGYVLYFLPFHDAARLDAMRLWQAMPFVRGQRVSAVR
FT                   PVWSYGGAMSLQYAAEAMAESLMALAAQK"
     atgtgcttga tttttaattt tatttttaga ttttttgcgc cgttggcgct gctgttctcc        60
     ctgttttcac ccagcgctca ggcgctgacg gtcagcgaca gccgcggtac tcatcagcta       120
     ccggccgtgc cgacgagagc cgtggtgctg gactgggatc tgctggagca gaccattgag       180
     ctgggggtga cgccgctggc tgccaccgat ctggacagct accgcgaatg ggtggcacag       240
     ccgccgatac cggcgcagac gcagagcgtc ggcagccgtg aagagccgaa tctggagcgc       300
     atcgcggcgc tgaaacccga tgtgatcctc gccagcgaaa tgcagcaggc gctgctgccg       360
     cgcctgatgc agattgcgcc ggtgctgtat tacaccaatt tttccgccgc ggacgatcac       420
     gccgcggtgg cgatagcgca gttccgccag ctggcgcagg cgtttggtcg tgaggcgatc       480
     gcggagcaga agctggccgc gatgcaggcc cgctttcagc atttatcacg ggcgctgcgc       540
     gcggcgtttc agggccagct ccccgccgtc acggtgatgc gctttgccag cacgacttca       600
     acctacctgt ataccactaa ctcgatgccg gtctatgtcc tgcgccagct ggggatctcg       660
     cctgcactga cgccgccgcc ggcgcgctgg gggattgtcc ggcagccgat cgccgggcta       720
     cagcgggtcg gccaaggcta cgtgctctac tttttgcctt ttcatgacgc cgcgcgcctg       780
     gatgcgatgc ggctatggca ggcgatgccg tttgtccgcg ggcagcgggt gagcgccgtc       840
     cgtccggtct ggagctatgg cggcgcgatg tcgttacagt atgccgcaga ggcgatggcg       900
     gaaagcctga tggcgctggc ggcgcagaaa tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page