(data stored in ACNUC7421 zone)

EMBL: CP001600.PE664

CP001600.PE664       Location/Qualifiers
FT   CDS_pept        707118..709112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0715"
FT                   /product="ABC transporter, iron chelate uptake transporter
FT                   family, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0715"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67936"
FT                   /db_xref="GOA:C5B7Q9"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7Q9"
FT                   /protein_id="ACR67936.1"
FT                   /translation="MSGAVRLAAPLLLLTLAVASLQWAQPLTLLQQWQLLLAPQQAQSL
FT                   DDILWLYSQLPRLAITLLVGATLGLAGSVMQQLTQNALMSPLTMGTSSGAWLALVLLAA
FT                   FWPGQQAQWGALAAMGGALLAFALIVLIAGLDNMTGLPMVIAGMVINILLGALASGVLL
FT                   LQHPYAQNIFLWGSGDLAQSDWGWVRWLLPRLTPALLLLLFAPRVLELLRLGHQGAQAR
FT                   GVALVPLFFALMLLTIWLVSAAVTAVGLIGFIGLLTPNIVRALGVRTPRGELYASLLGG
FT                   ALLLLLTDALAQGVSLWLGQLLPTGVVAAAIGAPALILFSRRRLSAPDGLGAPLISARG
FT                   RVSAWVSVALTALAALALLGYLTYQPEAAGWPFAWPQAYQWALRWPRALAALSCGGALA
FT                   LAGVLLQRLMYNPLASPDLLGVSSGATLTLVLAMLWCGQTLTALQQWGVGLAGSLAVLA
FT                   ALMALGRRQRYAPASVILSGIALTALLQALVQFCLAQGGQDSYRILQWLAGSTYRVTAA
FT                   QALLLSALTALLLLLALFVSRALTLLSIGRAFSQARGLNGAGAAALLLVLVALLCAIAT
FT                   AAIGPVAFVGLMAPHLAQMLGARTARAQMGLAALLGAATLLWADWLGQVLLYPRAMAAG
FT                   TLVAIVGAAYFLLLLIAGRLTRRRLQRVA"
     atgagcggcg cagtaaggct ggcggcgccg ctgctgctgt tgacgctggc cgtggcatcg        60
     ctgcagtggg cgcagccgct gacgctgctg cagcaatggc agctcttgct ggccccgcag       120
     caggcgcaga gtctcgatga cattctgtgg ctgtactcgc agctaccgcg tctggcgatc       180
     acgctgttgg tgggggcaac gctgggcctg gccggcagcg tgatgcagca gctgacccag       240
     aatgcgctga tgtcgccgct gacgatgggc acctcgtcgg gggcatggct ggcattggtg       300
     ctgctggcgg cattctggcc tgggcagcag gcgcagtggg gggcccttgc cgcgatgggg       360
     ggcgctttgc tggcctttgc cctgatcgtg ctgatcgccg ggctggacaa catgaccggc       420
     ctgccgatgg tcatcgccgg catggtgatt aacattctgc tcggtgcgct ggcatcgggg       480
     gtgctgctgc tacagcaccc ctatgcgcag aatatcttcc tgtggggcag cggcgacttg       540
     gcgcaaagcg actgggggtg ggttcgctgg ctgttacccc gcctgacgcc ggccctgctg       600
     ctgctgctgt tcgccccgcg ggtgctagag ctgctgcgcc tggggcacca gggggcgcag       660
     gcgcgcggcg tcgcgctggt tccgctcttt tttgcgctga tgctgctgac catctggctg       720
     gtctctgcgg cggtgacggc cgtcgggctg atcggtttta tcggcctgct gacgcccaac       780
     atcgtgcggg cgctgggggt gcggacgccg cggggcgagc tgtatgccag cctgctgggc       840
     ggagcgctac tgttactgct gaccgatgcg ctggcgcagg gggtgtcgct gtggctgggg       900
     cagctcttgc cgaccggcgt ggtggctgcc gctatcggcg caccggcgct gatcctgttc       960
     agtcggcgtc gcctgagcgc gccggatggc ctgggggcgc ccctgatatc ggcccgcggg      1020
     cgggtttcgg cgtgggtcag cgtggcgttg acggcgcttg ctgcgttggc gttgctcggc      1080
     tacctgacct accagccaga ggcggcgggc tggccctttg cctggccaca ggcgtatcag      1140
     tgggcgctgc gctggccgcg ggcgctggca gcgttgagct gcggcggggc gttggcgctg      1200
     gccggcgtgc tgttacagcg tctgatgtat aacccgttgg ccagccccga tctgctgggc      1260
     gtctcctccg gtgccacgct gacgctggtc ttggcgatgc tgtggtgtgg ccagacgctg      1320
     acggccttac agcagtgggg cgtcggcctg gcgggcagcc tggcggtact ggcggcattg      1380
     atggcgctgg ggcgtcgcca gcgttacgcc ccggccagtg tgatcctgag cggtatcgcg      1440
     ctgacggcgt tgctgcaggc gttggtgcag ttttgcctgg cgcagggagg ccaggacagc      1500
     taccgcattt tgcagtggct ggcgggctcc acctaccggg tgacggccgc gcaggcgctg      1560
     ctgctctctg cgctgacggc gctgctgctg ctgttggcgc tgtttgtatc gcgcgccctg      1620
     acgctgctct ccattggtcg cgccttttcc caggcccgcg gattgaacgg cgctggggcc      1680
     gcggcgctgc tgttggtgct ggtggcgctg ctgtgcgcca ttgcgacggc ggcgataggc      1740
     ccggtggcct ttgtcggcct gatggcgccg cacctggcgc agatgctggg cgcgcggacg      1800
     gccagggcgc agatggggct ggccgcgttg ctgggggccg cgacgctgct gtgggcagac      1860
     tggttggggc aggtcttact gtacccccgt gcgatggcag ccgggacgct ggtcgccatc      1920
     gtcggggccg cctatttcct gctgctgctg atcgctggcc gcctgacgcg ccgtcgtctt      1980
     cagcgcgtcg cgtag                                                       1995
//

If you have problems or comments...

PBIL Back to PBIL home page