(data stored in ACNUC7421 zone)

EMBL: CP001600.PE665

CP001600.PE665       Location/Qualifiers
FT   CDS_pept        709224..711389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0716"
FT                   /product="TonB-dependent siderophore receptor family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0716"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67937"
FT                   /db_xref="GOA:C5B7R0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030149"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C5B7R0"
FT                   /protein_id="ACR67937.2"
FT                   /translation="MSSLRLSHMGVGLLGAISLGCTSAAMAEESARPADEITVSGSQVA
FT                   LGDSYEGGQVARTGRLGMLGNSDFMDAPFILTSYTSALIEQQQAASVADVLQNDPTVRV
FT                   AKGFGNFQELYMIRGFPVYSDDMTLNGVYGILPRQFVAAEMLERVEVLRGANTFLNGAA
FT                   PGGSAVGGMVNLVPKRAGHTPLTRVTGGVQGDGQGYAALDVARRFGDDEANGVRVNLVG
FT                   RDGKSAVAREKQRLGALSVGFDHRRDRLQLSADIGYQDHHIDAPRPSVTPGGATLPAAP
FT                   SASKNYAQDWTYADEKQLFGVVRGEYLLNDNTRVWLGAGARQGKEHNLLANPTADGDGG
FT                   LSAFLFENVRQDNVLSADVGVRHDLITGSINHTLTLSAAAYQLRSKNAWAMSSTFSGFG
FT                   TLNDMWSVARPEATFFGGSLSDARETERNSSHSVALADTLGMLEDKIKLTLGGRWQRLE
FT                   TRSYDYDSGALSARYGKNALTPFVGALYQPSLEVALFANYAEALLPSGVAPATSNGVTV
FT                   SNAGQVFAPFRAQQIEAGAKYDNGMFGASVSLFQITRPEFRLDGTTYTDNGEQRNRGIE
FT                   LTLFGKPHERVTMLGGVTLLDARQQKSSPGGQDGKRAIGVPAVQANLNLGWETPFIDGL
FT                   ALEGRAVYTASQYADAANTLSIPAWVRVDLGARYALKLDGHDVTLRARVENLSDKRYWS
FT                   SVGGYPGSNYLVQGNPRTVIVSASYDF"
     atgtcatcac tgcgtttatc ccacatgggc gtggggctgt tgggcgcaat ctcgctaggc        60
     tgcacgtctg ctgcgatggc ggaggagagc gcccgcccgg cggatgagat cacggtcagc       120
     ggctcgcagg tcgcgctggg cgacagctat gagggcgggc aggtcgcgcg caccgggcgg       180
     ctgggcatgc tgggcaacag tgattttatg gatgccccct ttatcctgac cagctacacc       240
     tcggcgctga ttgagcagca gcaggcggcc agcgtggccg atgtgttaca aaacgatccc       300
     accgtgcggg tggccaaggg attcggtaac ttccaagagc tgtatatgat ccgcggtttc       360
     ccggtgtact ccgatgatat gaccctgaac ggggtctacg ggattttacc gcgtcagttt       420
     gtcgccgccg aaatgctgga gcgggttgaa gtgctgcgcg gtgccaatac cttcctgaac       480
     ggcgcggcgc ccggcggcag cgccgtcggg gggatggtga acctggtgcc gaagcgggcg       540
     ggtcatacac cgttgacgcg ggtcaccggc ggtgtgcagg gggatggcca gggctacgcg       600
     gcgttggatg tggcccggcg cttcggtgac gatgaggcca acggcgttcg ggttaatctg       660
     gtcggacggg atggtaagag cgcggtcgcc cgagagaaac agcgcctcgg cgcgctatcc       720
     gtcggtttcg atcatcgccg tgaccggctg cagctgtcgg cggacatcgg ctatcaggat       780
     caccatatcg atgcgccgcg ccccagcgtt acgccggggg gggccacgct gcctgcagcg       840
     ccgtcggcca gtaaaaacta tgcccaggac tggacctatg ccgatgagaa gcagctgttt       900
     ggcgtcgtgc gcggtgagta tttactgaac gacaacaccc gtgtctggct gggggcgggg       960
     gcgcggcagg gtaaagagca taacctgctg gctaacccca cggccgatgg cgatgggggg      1020
     ctctcggcct tcctgttcga aaacgtcagg caggataacg tgttgtctgc tgatgtcggt      1080
     gtacgtcacg atctgatcac cggcagcatc aatcatacgc tgacgctttc tgcggcggcg      1140
     tatcagctgc gttcaaagaa cgcttgggcc atgtcgtcca cgttcagtgg ttttgggacg      1200
     ctgaatgata tgtggtcggt tgcccgcccg gaggcaactt tctttggcgg atcgctcagc      1260
     gatgcgcggg agacggagcg taacagcagc cacagtgtgg cgctggctga taccctgggc      1320
     atgctggagg ataagattaa gctgacgctc ggcggccgct ggcagcgtct ggaaacccgt      1380
     tcttatgact atgatagcgg cgccctcagc gctcgctatg ggaaaaacgc cctgacgcct      1440
     ttcgtcggtg cgctatatca gccctctctg gaggtggcgc tgttcgccaa ctacgccgag      1500
     gcgctgctgc ccagcggggt ggcgccggca accagcaatg gcgtcacggt aagcaatgcc      1560
     ggccaggtct ttgcgccgtt ccgcgcccag cagatcgagg cgggggccaa gtatgacaat      1620
     ggcatgtttg gggcatcagt cagcctgttc cagattaccc gcccggagtt tcgcctggac      1680
     ggtaccacct ataccgataa tggcgaacag cgtaaccgcg ggattgagct gacattgttt      1740
     ggtaaacccc atgagcgcgt cacgatgctg gggggcgtaa cgctgctgga tgcccggcag      1800
     caaaagagct cgcccggcgg tcaggacggg aagcgggcga taggcgtacc ggcggttcag      1860
     gcaaacctga acctggggtg ggagacgccg tttatcgacg gactggcgct ggaggggcgc      1920
     gcggtctata ccgcctcaca gtatgcggat gccgccaata ccctgtctat tccggcgtgg      1980
     gtacgcgtcg atctgggggc acgctatgcg ctgaagctcg acggtcatga cgtgacgctg      2040
     cgcgcgcggg tcgagaacct gagcgataag cgctactggt cgtccgtcgg cggttatccg      2100
     ggcagtaact atctggtgca gggcaacccg cgcaccgtta tcgtctctgc cagctacgac      2160
     ttctaa                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page