(data stored in ACNUC7421 zone)

EMBL: CP001600.PE666

CP001600.PE666       Location/Qualifiers
FT   CDS_pept        complement(711429..712031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0717"
FT                   /product="3-isopropylmalate dehydratase, small subunit,
FT                   putative"
FT                   /EC_number="4.2.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0717"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67938"
FT                   /db_xref="GOA:C5B7R1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:C5B7R1"
FT                   /protein_id="ACR67938.1"
FT                   /translation="MTEFTRHTGIVVPLDAANVDTDAIIPKQFLQKVTRSGFGRHLFHD
FT                   WRFLDEAGERPNPAFVLNQPPFQQGSILLARENFGCGSSREHAPWALTDYGFRVVIAPS
FT                   FADIFYGNAFNSQLLPIILDEAQIAALFTLVSASPGIAFSVDVEQQTLQAGDTRYTFTL
FT                   DPFRRHCLIHGLDSIGLTLRHASAIDDYEARRPAFLR"
     atgactgagt tcacccgcca taccggtatc gtcgtcccgc tggacgccgc caacgtggac        60
     accgatgcca ttattcccaa gcagtttctg cagaaggtga cacgcagcgg atttggccgc       120
     cacctgtttc acgactggcg ctttctggac gaggctgggg agcggcccaa cccggcgttc       180
     gtcctgaatc aacccccgtt ccagcagggc agtattctgc tggcgcggga aaactttggc       240
     tgtggttcat cgcgtgagca cgcgccctgg gcgctgaccg actacggctt ccgtgtggtt       300
     atcgccccca gctttgccga tatcttttac ggcaatgcgt ttaacagcca gctgctgccc       360
     attatcctcg acgaggcaca gatagcggcg ctgtttaccc tggtcagcgc atcgcccggc       420
     atcgcattta gcgtggacgt agagcagcag acgctgcagg cgggcgacac gcgctatacc       480
     tttacgctgg acccgttccg ccgccactgt ctcatccacg gcctggacag cattggcctg       540
     acgctgcggc atgcgtcggc gatcgacgac tacgaagcgc gtcgacccgc gtttctgcgt       600
     taa                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page