(data stored in ACNUC7421 zone)

EMBL: CP001600.PE7

CP001600.PE7         Location/Qualifiers
FT   CDS_pept        complement(8477..8746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0007"
FT                   /product="hypothetical protein"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67269"
FT                   /db_xref="InterPro:IPR010780"
FT                   /db_xref="UniProtKB/TrEMBL:C5BHD1"
FT                   /protein_id="ACR67269.1"
FT                   /translation="MTRVGPHQGYYAGTKNDLQMISSEESGWVMRPLLVLDLPLSALVD
FT                   TLLLPYDYYRTDDEPATESPRARVQRAEQASATNGMVPPAAPEN"
     atgacgcgcg tcggccccca ccagggctac tatgcgggaa ccaaaaacga tctgcagatg        60
     atcagcagcg aggagagcgg ctgggtcatg cgcccactgt tagtattgga tctaccgctg       120
     tcggcgctcg tcgatacgct gctgttgccc tatgactact accgcaccga cgacgagcca       180
     gccacagaat cgccgcgcgc ccgggtgcag cgcgccgagc aggccagcgc taccaacggt       240
     atggtgccgc cggcagcacc agagaactga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page