(data stored in ACNUC7421 zone)

EMBL: CP001600.PE72

CP001600.PE72        Location/Qualifiers
FT   CDS_pept        complement(67220..68740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0075"
FT                   /product="Mg chelatase-like protein"
FT                   /note="Mg chelatase homolog"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67335"
FT                   /db_xref="GOA:C5BBA0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA0"
FT                   /protein_id="ACR67335.1"
FT                   /translation="MTLATVYTRAALGIQAPEVRIEAHIGNGLPGFTLVGLPETAVREA
FT                   KDRVRCAMLNSGFQFPPKRITLNLAPADLPKEGGRYDLPMALALLLASGQLAPHVSVCN
FT                   YEFIGELALSGDLRPVQGALPAALSAAHAKRTLIAPSDNAAELGLLAAPRPPIAPSLLA
FT                   VCAFLSGQASLEAAPAGEMTSGGTDTGDMADIIGQAQARRALEIAAAGGHNLLLIGPPG
FT                   TGKTMLACRLPGLLPPMTPDEALEQAAISSLAYPGTMPPRYGVRPFRAPHHSASMAALI
FT                   GGGPLPKPGEISLAHHGVLFLDELAEFDRRTLDALREPLESGVVHLSRARIKVSFPARV
FT                   QLVAAMNPSSGGHADGRDRRAAAAQVLRYLSRLSGPLLDRFDLSIDVPPLSPGLLARQR
FT                   ADGEDSATLRRRVCAARVRQYARGGRLNAHLEGAARDRDCRLAPDDALYLEQALTRLAL
FT                   SVRAWHRLLKVARTLADLEGCDNIARRHLAEALSYRAMDRLLLTLQRG"
     atgactctgg ccactgtata cacgcgcgcc gccctgggta ttcaagcccc cgaggtccgc        60
     attgaggcgc atatcggcaa cggcctgccg ggctttaccc tggtgggtct accggaaacg       120
     gccgtacgcg aagccaaaga tcgggtacgc tgtgccatgt tgaacagcgg atttcagttc       180
     ccgccgaagc gcattacgtt gaacctggca cccgccgatc tgcccaaaga aggggggcgt       240
     tacgatctgc cgatggcgct ggcgttgctg ctggcgtccg ggcagctggc cccgcacgta       300
     tccgtttgca actacgagtt tattggagag ttggccctgt ccggcgatct gcgcccggtc       360
     cagggggcgc tacccgccgc gctgagcgcc gcccacgcga agcgtaccct gatagcgccc       420
     agtgataacg cggccgagct tgggctgctg gcggccccac ggccccccat cgcgccatcg       480
     ctgctggccg tctgcgcctt tctgagcggc caggcatccc tggaggccgc gccggccggc       540
     gagatgacga gcggcggtac agacaccggc gatatggccg acattatcgg ccaggcacag       600
     gcacgacggg cgctggagat cgccgccgcc ggcggacata acctgctgct gatcggtcct       660
     ccgggcaccg gtaaaaccat gctggcctgc cgcctgccag ggctgctgcc gccgatgacc       720
     ccggatgagg cactggagca ggcggccatc agcagtctgg cctacccggg caccatgccg       780
     ccgcgctatg gcgtgcgccc ctttcgcgca ccacatcaca gcgcctccat ggccgcgttg       840
     atcggcgggg ggccgctgcc gaaacccggc gagatctcgc tggcccatca cggtgtcctg       900
     tttcttgacg aactggccga atttgaccgg cgaaccctgg acgccttgcg cgaaccgctg       960
     gagtccggcg tcgtccatct gtcccgcgcc aggataaagg tcagctttcc cgcccgggta      1020
     cagctggtgg cggccatgaa tcccagcagc ggtggccacg ctgacgggcg cgatcgccgg      1080
     gcggcggcgg cgcaggtgct aagatacctc tcccggctgt ccggccccct gcttgaccgc      1140
     ttcgatctgt cgattgatgt tccgccgctg tcaccgggcc tgctggcccg ccaacgggcg      1200
     gatggcgaag acagtgcgac cctacgccgg cgggtctgcg ccgcccgggt gcggcagtat      1260
     gcccgtggcg gccggctcaa tgcgcatctg gagggcgccg cccgcgatcg cgactgccgt      1320
     ctggctccgg acgatgccct ctatctggag caggcgctca cgcgcctggc actatcggta      1380
     cgcgcctggc accggctgct gaaagtggcg cgtacgctgg cggatctgga aggatgcgat      1440
     aacattgcac gccgccatct ggccgaggcg ctgagctacc gcgccatgga tcggctactg      1500
     ctcaccctgc aaaggggcta a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page