(data stored in ACNUC7421 zone)

EMBL: CP001600.PE74

CP001600.PE74        Location/Qualifiers
FT   CDS_pept        70627..72276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0077"
FT                   /product="acetolactate synthase isozyme II, large subunit,
FT                   putative"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67337"
FT                   /db_xref="GOA:C5BBA2"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA2"
FT                   /protein_id="ACR67337.1"
FT                   /translation="MNGAQWVVQALRAQGVNQVFGYPGGAIMPLYDALYDGGVAHLLCR
FT                   HEQGAVMAAIGYARASGRVGVCIATSGPGATNLITGLADAMMDSVPLVAITGQVASALI
FT                   GTDAFQEMDVLGLSLACTKHSFMVTSLAELPEVMDRAFAIAVQGRPGPVLIDIPKDIQL
FT                   AQGDLATPLCSVAQVQPSCPPAALAQARAMLTQAQRPVLYVGGGVGMAGAVPSLRSLVS
FT                   RSGMPVAATLKGLGAADDRHPAYLGMLGMHGCKAANLAVQQCDLLIAVGARFDDRVTGR
FT                   LDAFAPQAQVIHLDIDPAELGKVRQAHVSLCGDLNLLLSALTMRLEIAPWLQQVAALKA
FT                   QHAWRYDHPGEAIYAPLFLRQLSGCKPPQAVVTTDVGQHQMWSAQHMRFSLPQDFITSS
FT                   GLGTMGFGIPAAVGAQVARPDDCVICVSGDGSFMMNVQELGTIKRARLPLKIVLLDNQR
FT                   LGMVRQWQQLFFDARYSETDLSDNPDFLTLAQAFGIPGQRISRKAQVAEALEALFSTPG
FT                   PYLLQVAIDEFENVWPLVPPGAGNESMLENVS"
     atgaatggag cgcagtgggt agtacaagcg ttacgtgcgc agggagtgaa ccaggttttc        60
     ggttatccgg gcggcgcgat tatgccgctg tacgatgcgc tgtatgacgg cggtgtggcc       120
     cacttgctgt gccgacacga acagggcgcg gtgatggcgg cgattggcta tgcccgcgcc       180
     agcggccgcg ttggcgtctg tatcgccaca tcgggtcccg gtgccaccaa cctgatcact       240
     ggtttggccg atgccatgat ggattcggta ccgctggtgg cgatcaccgg acaggtcgct       300
     tcggcgctga ttggcaccga cgcttttcag gagatggatg ttctgggact gtcgctggcc       360
     tgtaccaaac acagctttat ggtgacctcg ctggccgagc tgccggaggt gatggatcgc       420
     gcgtttgcta ttgcggtgca ggggcgcccg gggccggtgc tgatcgatat tcccaaagat       480
     attcagctgg cacagggaga tctggctacg ccgttgtgta gcgtggcgca ggtgcagcca       540
     tcctgcccgc cagcggcgtt ggcgcaggcg cgagccatgc tgacgcaggc gcagcgtccg       600
     gtgctgtacg tggggggcgg cgtagggatg gctggtgcgg tgccatcgct gcgctcgctg       660
     gtgtcgcgca gcgggatgcc ggtcgccgca accctaaagg ggctgggcgc cgccgatgat       720
     cgtcaccccg cttacctggg gatgctggga atgcacggct gtaaggcggc caatctggcg       780
     gtgcagcagt gtgatttgtt gatcgccgtc ggcgcccgct ttgacgatcg ggttaccggc       840
     cgccttgatg cctttgcacc gcaggcgcag gtgatccatc tggatatcga tccggcggag       900
     ctgggcaaag tgcgtcaggc gcacgtgtcg ctgtgtggcg atctgaacct gctgctgtcg       960
     gcgttgacca tgcggttgga gatcgcgcca tggttgcagc aggtggcggc gcttaaggcg      1020
     cagcatgcct ggcgctatga ccatcccggc gaagctatct atgcgccgct gtttttgcgt      1080
     cagctctccg ggtgtaagcc gccgcaggcg gtggtcacca ccgatgtcgg acagcatcag      1140
     atgtggagcg cccaacatat gcgattttcc ctgccgcagg attttattac ctccagcggg      1200
     ctggggacca tggggttcgg gatcccggcc gcggtcggcg cacaggtcgc tcgccctgac      1260
     gactgcgtga tctgcgtatc cggcgatggc tctttcatga tgaacgttca ggagctcggt      1320
     accatcaagc gggccaggct gccgctgaaa attgtgctgc tggataacca gcgtctgggg      1380
     atggtgcgcc agtggcagca gctgttcttt gatgcccgct acagcgaaac cgatctctct      1440
     gataatccgg attttttaac cctggcgcag gcgtttggta tcccggggca gcgcatcagc      1500
     cgcaaggcgc aggtggcaga ggcgctggag gccctgttta gtaccccggg cccttatctg      1560
     ctgcaggtcg ctatcgacga atttgaaaat gtctggccgc tggtgccgcc gggcgcaggc      1620
     aacgaatcta tgctggagaa cgtatcatga                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page