(data stored in ACNUC7421 zone)

EMBL: CP001600.PE75

CP001600.PE75        Location/Qualifiers
FT   CDS_pept        72273..72563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0078"
FT                   /product="acetolactate synthase isozyme II, small subunit,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67338"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA3"
FT                   /protein_id="ACR67338.1"
FT                   /translation="MMQSPSFQHHLAIQARRRPEILERVLRVVRHRGFEIHAMNMAQDG
FT                   DCDSVNIELTVASTRPVTLLSSQLIKLLDVARVDVSAPRSLRMLPRRQVLG"
     atgatgcaga gcccttcatt ccaacaccat ctggctattc aggcacgtcg ccgtccggag        60
     atcctggagc gggttttgcg cgtggtgcgc caccgaggct ttgagatcca cgccatgaac       120
     atggctcagg acggcgactg tgatagcgtc aatattgagc tgacggtggc cagtacgcgg       180
     ccggtcacac tgctgtcgtc ccagctgatt aagctgctgg acgtcgctcg ggttgatgtc       240
     agcgccccac gatcgttgcg catgctgccc cgtcgccagg tgctgggctg a                291
//

If you have problems or comments...

PBIL Back to PBIL home page