(data stored in ACNUC7421 zone)

EMBL: CP001600.PE76

CP001600.PE76        Location/Qualifiers
FT   CDS_pept        72617..73546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0079"
FT                   /product="branched-chain amino acid aminotransferase,
FT                   putative"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67339"
FT                   /db_xref="GOA:C5BBA4"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBA4"
FT                   /protein_id="ACR67339.1"
FT                   /translation="MTTKKADYIWFNGDMVPWGEARVHVMSHALHYGTSVFEGVRCYET
FT                   HRGPAVFRHREHMQRLHDSARIYRMPLAYSVEELMAACRETLRRNQLSSAYIRPLVFIG
FT                   DVGMGVNPPAGYGTDVILAAFPWGAYLGEEALEQGIDAMVSSWHRAAPNTIPTAAKAGG
FT                   NYLSSLLVGSEARRHGYQEGIALDVHGYVSEGAGENLFMVKNGVIFTPPFTSAALPGIT
FT                   RDAIITLAQAQGLEVREQVLSREALYLADEIFMSGTAAEITPVRSVDGIQVGIGRCGPI
FT                   TKRVQQAFFGLFNGQTEDRFGWLDPVNP"
     atgaccacca agaaagcgga ttatatctgg tttaacggcg atatggtgcc ctggggcgag        60
     gcccgggtac acgtgatgtc tcacgctctg cactacggta cctcggtttt tgagggggtg       120
     cgttgctacg aaacccaccg tggcccggcg gtattccgcc accgtgaaca tatgcagcgc       180
     ctgcatgatt cggcgcgtat ttatcgcatg ccgctggcct acagcgttga ggagttgatg       240
     gccgcctgcc gtgaaaccct gcgccggaat cagctgtcga gcgcctatat ccgcccgctg       300
     gtctttatcg gtgacgtcgg catgggcgtg aatccgcccg caggctatgg cacggatgtg       360
     atccttgccg ctttcccctg gggagcctat ctgggggagg aggcgctgga gcagggtatc       420
     gatgccatgg tctcctcctg gcatcgtgcc gctcccaata ccattccgac cgcggccaag       480
     gccggtggaa actatctctc ttcactgctg gtgggatcag aggcacggcg ccacggttat       540
     caggagggca ttgcgctgga tgtccacggc tatgtttctg agggggcagg tgaaaacctg       600
     tttatggtga aaaatggggt gatcttcacg ccgccgttta cctccgctgc cctgccgggg       660
     atcacccgtg acgcgatcat caccctggca caggcgcagg ggctggaggt gcgggagcag       720
     gtgctgtccc gcgaggcact gtacctggcc gatgaaattt ttatgtcggg tacggcggca       780
     gaaattacgc cggtgcgcag cgtggatggt atccaggtcg ggattggccg ctgtggccct       840
     atcaccaagc gggtacaaca ggcctttttt ggcctgttca acggccagac cgaggaccgc       900
     tttggctggc tggatccggt gaatccataa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page