(data stored in ACNUC7421 zone)

EMBL: CP001600.PE95

CP001600.PE95        Location/Qualifiers
FT   CDS_pept        95887..97137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0098"
FT                   /product="polysaccharide biosynthesis family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67358"
FT                   /db_xref="GOA:C5BBC3"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR032896"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC3"
FT                   /protein_id="ACR67358.1"
FT                   /translation="MSLARASLWTAGSTLIKIGAGLVVVKLLAVAFGPVGVGQAANFRQ
FT                   VITVLGVLSGAGIFNGITKYVAEYRQQPLRLRALLGTASTMILGFSLLLALIFTLGAAP
FT                   ISVALFGHDDYQAVIRLVALLQMGIACANYCLAVIKGYRDARGNALAVALGSLLGVAAY
FT                   TLSYFWGGYRGALAGLALVPAVATLPALWVLWRQRHIPWRYFRPSWDRPLAAGLGKFTL
FT                   MAVMTAVTMPVAYVMMRNQLAALDGWEAVGIWQGVSGISDAYLQFITASFSVYLLPTLA
FT                   GLRSRQAVGQEILRALRFVLPAVAAVSFMVWLLRDLVIWLLLSGKFSAMRDLFAWQLTG
FT                   DVFKVGAYVFGYLVIAKASLRFYLLCEISQFILLTLLSRFLIPQHGALGAAQAYMATYI
FT                   IYFLLCGSVFWIYRNRA"
     atgtccctgg cacgcgcatc gctgtggacc gccggttcga ccttgatcaa gatcggcgcc        60
     gggctggtgg tggtcaagct gctggccgtg gcgttcggcc ccgtcggcgt ggggcaggcg       120
     gccaactttc gtcaggtgat caccgttctg ggggtgctgt cgggcgccgg gattttcaac       180
     ggtatcacca agtatgtcgc agagtatcgc cagcagccgc tgcggctacg ggcgctgctg       240
     ggcaccgcat cgacgatgat cctggggttc tccctgctgc tggcgctgat ctttaccctg       300
     ggggctgcgc cgatcagcgt ggcgctgttt ggccacgatg actatcaggc ggtgatccgc       360
     ctggtggcgt tgctgcaaat gggcattgcc tgcgctaact actgcctggc ggtgatcaag       420
     gggtatcgcg acgctcgcgg caatgcgctg gcggttgcgc tcggcagcct gctgggcgtg       480
     gcggcctata ccctgagcta tttttggggt ggctaccgcg gtgcgctggc cgggctggcg       540
     ctggtaccgg cggtcgccac gctgccggcc ctatgggtgc tgtggcgcca gcgtcatatc       600
     ccgtggcgct attttcgtcc gtcctgggat cggccgctgg ccgctggcct ggggaagttt       660
     accctgatgg cggtgatgac cgcggtgacg atgccggttg cctatgtcat gatgcgcaat       720
     cagctggcgg cgctggatgg ctgggaggcc gtcgggatct ggcaaggggt gagcggcata       780
     tccgacgcct acctgcagtt tattaccgcc tcgttcagcg tttacctgct gccgaccctg       840
     gccgggctgc gcagccgtca ggcggttggg caggagatcc tgcgcgcgct gcgctttgtt       900
     ctgcccgcgg tggcggccgt cagctttatg gtctggctgc tgcgcgatct ggtgatttgg       960
     ctgctgctgt cggggaagtt cagcgccatg cgtgacctgt ttgcctggca gctgacgggg      1020
     gatgtgttta aggtgggcgc ctatgtcttc ggctatctgg tgatcgccaa agcctcgctg      1080
     cgcttttacc tgctgtgcga aataagccag tttatcctgt tgaccctgct gtcgcgcttt      1140
     ctgatcccgc agcatggcgc cttgggtgcc gctcaggcct atatggcaac ctatattatt      1200
     tatttcctgc tgtgtggcag cgtattttgg atttatcgta accgcgcatg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page