(data stored in ACNUC7421 zone)

EMBL: CP001600.PE97

CP001600.PE97        Location/Qualifiers
FT   CDS_pept        98207..99595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0100"
FT                   /product="ECA biosynthesis protein WzyE, putative"
FT                   /note="ECA biosynthesis protein WzyE, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67360"
FT                   /db_xref="GOA:C5BBC5"
FT                   /db_xref="InterPro:IPR010691"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC5"
FT                   /protein_id="ACR67360.1"
FT                   /translation="MTLMQFAGLTLVYFFSLLFVAFLTYKEFRRVRFNFNVFFSLLFLL
FT                   TFYFGFPLTCTLVFRFDVATVPAEEMLYALLSATAFYALYYVTYKTRLRSATSAPGSGS
FT                   AWLQLNRVEAQLTWILLALVALVTVTIFFLNNGFLLFKLHSYSQIFSSGVSGVALKRFF
FT                   YFFIPAMLVVYFLRQTQAAWLFFLVSTVIFGLLTYVIVGGTRANIIIAFALFLFIGIQR
FT                   GWITLWMLALAGVVGVVGMFWLALKRYGLAVSGDEAFYTFLYLTRDTFSPWENLALLLQ
FT                   HYTQIDFQGLAPIARDFYVFIPGWMWPDRPHLVLNSANYFTWQVLDNHSGLAISPTLIG
FT                   SLVVMGGAAFIPLGAIAVGLIIKWFDWLYTRGCTASNRYRGAVIQAFCFGAVFNMIVLA
FT                   REGLDAFVSRVVFFCIIFGCCLLLAKLLYWLFDAAGLIRARTAIAAPSVGEGSPTHKDR
FT                   NDGE"
     atgaccctga tgcagtttgc cggtttgacg ctggtgtact ttttctcgct gctgtttgtg        60
     gcgtttctga cctacaaaga gtttcgccgg gttcgcttta attttaatgt gttcttttca       120
     ctgttatttc tgctgacatt ctattttggc tttccgctga cctgtacgct ggtgttccgc       180
     tttgacgtgg cgacggtgcc ggcggaggag atgctgtacg ccctgctgtc ggccacggcg       240
     ttttacgctc tctattacgt cacctacaag acgcggctgc gttcagcgac gtcggcgccg       300
     ggcagcggct ccgcctggct acagctcaac cgggtggagg cgcagctgac ctggatattg       360
     ctggcgctgg tggcgctggt gaccgtcacc attttcttcc tcaacaacgg ttttttgctg       420
     ttcaagctgc actcctatag ccagatcttc tccagtggcg tctccggcgt ggcgctaaag       480
     cgcttctttt acttttttat tccggcgatg ctggtggtgt actttctccg tcagacgcag       540
     gccgcctggc tgtttttcct ggtcagtacc gtgatttttg gcctgttgac ctacgtcatc       600
     gtcggcggaa cgcgcgccaa catcatcatc gccttcgccc tgttcctgtt tatcggtatc       660
     cagcgcggct ggataaccct gtggatgctg gcgctggccg gcgttgtcgg ggtcgtgggc       720
     atgttctggc tggccctcaa gcgctacggt ctggcggtaa gcggcgatga ggccttctac       780
     acctttcttt atctgacgcg tgacactttc tcgccctggg agaatctggc gctgctgctg       840
     cagcactata cccagataga ttttcaggga ctggcgccga ttgcccgcga tttctatgtc       900
     tttatccccg gttggatgtg gccggatcgg ccgcatctgg tgctgaacag cgccaactat       960
     tttacctggc aggtgctcga caaccattcg gggctggcca tctcccccac cctgatcggt      1020
     tcgctggtgg tgatgggcgg cgcggcgttt attccgctgg gggcgatcgc cgtggggctg      1080
     attatcaagt ggttcgactg gctgtatacc cgggggtgta cggcgtcaaa ccgctaccgg      1140
     ggcgcggtga tccaggcgtt ttgcttcggg gcagtgttta atatgatcgt actggcgcgc      1200
     gagggacttg atgcctttgt ttcgcgcgtg gtgtttttct gtattatttt cggctgctgt      1260
     ctgctgctgg caaagctgct gtactggctg tttgatgcgg cggggctgat ccgcgcacgc      1320
     acggctatcg cggcgccttc tgtcggggag ggatcgccga cccacaagga taggaacgat      1380
     ggagagtaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page