(data stored in ACNUC7421 zone)

EMBL: CP001600.PE99

CP001600.PE99        Location/Qualifiers
FT   CDS_pept        complement(101525..102724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NT01EI_0107"
FT                   /product="HemY protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NT01EI_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACR67362"
FT                   /db_xref="GOA:C5BBC7"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C5BBC7"
FT                   /protein_id="ACR67362.1"
FT                   /translation="MLKVLLLFIILIAGIVLGPMLAGHQGYVLIQTDSYNIETSVTSLV
FT                   IMLILLMLALFALEWLLRRLLRTGARTRGWFIGRKRTRARRQTCAGLLKLTEGDYGQVE
FT                   KLLARNADHADQPLVNYLLAAEAAQQRGDELRANQYLERAAEVAGSDPLPVDITRVRLQ
FT                   LARGENHAARHGVDALLNYAPRHPEVLRLAEQAYLRTDAFGPLLEILPALAKQGLHSDD
FT                   DIEKLQIRAYIGLMDQAMANGGSEELKQWWKAQRRTTRHETVLQVALAEHLIECDDHGA
FT                   AQQIVVDGLKRRFDERLVQLMPQLKSGNPEQLEKLLQQQIRQHGASALLNSTLGQLLMR
FT                   HGEWQQAAEVLRAALKQRPDPYDYAWLADTLDKLHRPEEAAQMRRDGLLLTLHQDQPTA
FT                   "
     atgctcaagg ttctgctgct gtttatcatt ctaatcgccg gcatcgtgct cggtccgatg        60
     ctggctggcc atcaggggta tgtgctgatc cagaccgaca gctacaatat cgagaccagc       120
     gtaacctcgc tggtgatcat gttgatcctg ttgatgctcg cgctgtttgc cctggaatgg       180
     ctactgcggc ggttgctgcg caccggcgcc cgtacccgcg gctggtttat cggacgtaag       240
     cgcacccgcg cgcgccgcca gacctgtgca ggattgctca agctgacgga gggcgactac       300
     ggccaggttg aaaaactgct cgcgcgcaat gccgatcacg ccgatcagcc actggtaaac       360
     tacctgctgg cggccgaagc tgcacaacag cgcggcgatg agctgcgcgc caaccagtat       420
     ctggagcgcg ctgccgaggt cgccggaagc gatccgctgc cggtcgatat cacccgtgta       480
     cgcctgcagc tggcgcgtgg ggagaaccac gctgcccgcc acggggtgga tgccctgctc       540
     aactatgcgc cgcgtcatcc cgaagtcctg cgtctggcag agcaggccta tctgcgtacc       600
     gatgccttcg gcccactgtt ggaaatcctg cccgcgttgg ccaagcaggg gctgcacagc       660
     gatgatgata tcgagaagct gcagatccgg gcctatatcg gcctgatgga tcaggcgatg       720
     gccaacggcg gcagcgaaga gctgaaacag tggtggaaag cgcagaggcg tacaacgcgt       780
     catgaaaccg tgctgcaggt cgccctggcc gaacacttga tagagtgtga cgatcacggc       840
     gccgcgcagc aaatcgtcgt cgacggactg aagcgccgct ttgatgagcg cctggtgcag       900
     ctgatgccgc aactgaagtc cggtaatccc gaacagctgg agaagctgct acaacaacag       960
     atccgtcagc atggcgccag tgcgctgctc aacagcaccc tggggcagct gctaatgcgc      1020
     cacggcgagt ggcagcaagc ggcagaggtg ctgcgcgccg cgctcaagca acgcccggat      1080
     ccctatgact acgcctggct cgccgatacg ctggacaagc tacaccgccc ggaggaggcc      1140
     gcacagatgc ggcgcgacgg cctgctgcta accctgcacc aggatcagcc gaccgcctga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page