(data stored in ACNUC30630 zone)

EMBL: CP001606.PE115

CP001606.PE115       Location/Qualifiers
FT   CDS_pept        complement(134530..134712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47080"
FT                   /protein_id="ACS47080.1"
FT                   /translation="MRIRHGHLFTRLAIAAIAALRDAGVSVETHEMNGWPHGFGADGGW
FT                   IDQYFAPWLTTVFAR"
     atgcgaatac gccacggcca tttgttcaca cgactcgcca tcgctgcgat tgcggcgttg        60
     cgtgacgcag gcgtgagcgt cgaaacccat gagatgaacg gctggccgca cggtttcggc       120
     gccgacggcg gctggatcga ccagtatttc gccccatggc tcaccaccgt gttcgcccgg       180
     taa                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page