(data stored in ACNUC30630 zone)

EMBL: CP001606.PE141

CP001606.PE141       Location/Qualifiers
FT   CDS_pept        complement(163525..163809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0145"
FT                   /product="hypothetical protein"
FT                   /note="COG4453 Uncharacterized protein conserved in
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47106"
FT                   /protein_id="ACS47106.1"
FT                   /translation="MPYNIVMATMTRTARIDMRLTEEEKRLIEQASAATGSRLTTWCIN
FT                   NLINDAKRDLHANAIIRLSDEAFDRFVENLDRPLTEKQQQFLAYQPEWA"
     atgccgtaca atattgtcat ggcaaccatg acacgaaccg cccgcatcga catgcgactc        60
     accgaagagg aaaaacgact cattgaacag gccagcgctg cgacgggatc tcgcctcacc       120
     acctggtgca tcaacaacct catcaacgac gccaaacgcg acctgcacgc caacgccatc       180
     attcgcctat cagatgaggc cttcgacagg ttcgtcgaga atctggacag gccattgacc       240
     gagaaacagc agcagttcct cgcatatcag ccggaatggg catga                       285
//

If you have problems or comments...

PBIL Back to PBIL home page