(data stored in ACNUC30630 zone)

EMBL: CP001606.PE146

CP001606.PE146       Location/Qualifiers
FT   CDS_pept        complement(170428..171525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0150"
FT                   /product="electron transport complex, RnfABCDGE type, D
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47111"
FT                   /protein_id="ACS47111.1"
FT                   /translation="MQFIDAFNPAFRTMGRIGESKNHLPLWVFPYTQARFRFTGTSLAV
FT                   RLRNFWNYGHTRIGVIIDNTQFSVRVPSPVEPEPDAAVSVGEDGMLTIRIASHLPNIEH
FT                   RAIVFKREDGGMHYMEFAGVEIDDDAQILAPAEPASTRRIEVYGDSVSCGERNEAVLCT
FT                   GKADPDEDLSAYSNSWFAYDAIAARALGADLRIISQGGAPLLDGIGWFNAPDYLGMESI
FT                   WDRVQYNPALGEPTDWDFRDDDPQVVIVALGQNDSHPYDFMAADYTGEQAANWRARYAE
FT                   FLGDLLERYPDAHIICTTTVLQHDRNWDRAIDEVVSELDNPQITHFDYSRAGTGTPGHP
FT                   RIAEDEEMARELVAYIDSFGAELWQ"
     atgcaattca ttgacgcatt caatccggct ttccgcacga tgggacgcat cggcgaatcg        60
     aagaaccact tgccgctgtg ggtgttcccc tacacgcagg cgcggttccg cttcaccggc       120
     acctccctcg ccgtgcgtct tcgcaatttc tggaactacg gccacacgcg catcggtgtg       180
     atcatcgaca acacccagtt cagcgtgcgt gtgccgtcgc ccgtcgaacc cgagcccgac       240
     gccgccgtga gcgtggggga agacggcatg ctcaccattc gcattgcaag ccacttgccg       300
     aacatcgagc accgcgcaat cgtattcaag cgcgaagatg gcggcatgca ctacatggag       360
     ttcgccggcg tggagattga cgacgacgcg cagattctcg cacctgccga acccgccagc       420
     acacgccgca tcgaggtgta cggcgactcg gtgagctgcg gcgagcgcaa cgaggccgtg       480
     ctctgcaccg gcaaggccga cccggacgaa gatctgagcg cctacagcaa ctcatggttc       540
     gcctacgatg ccatcgccgc ccgcgcattg ggtgccgacc tgcgcatcat ctcacaaggc       600
     ggcgcaccgc tgcttgacgg catcggctgg ttcaacgcgc ccgattacct cggcatggag       660
     agcatctggg atcgtgtgca gtacaatccc gcgctcggcg agcccaccga ctgggatttc       720
     cgcgacgacg acccgcaggt ggtcattgtg gcgctcggcc agaatgattc gcacccgtac       780
     gatttcatgg ccgcagatta caccggcgag caggccgcga actggcgcgc ccgctatgcc       840
     gagttcctgg gcgatctgct cgaacggtac ccggatgcgc atatcatctg cacgacgacc       900
     gtgctgcagc atgaccgcaa ctgggaccgc gcgatcgacg aagtggtgag cgagctcgac       960
     aatccgcaga ttacgcactt cgattattcg cgcgcaggaa ctggcacccc ggggcacccc      1020
     cgcattgccg aggacgaaga gatggcgcgc gaactggtcg cctacatcga ttcgttcggc      1080
     gcagagctgt ggcaatag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page