(data stored in ACNUC30630 zone)

EMBL: CP001606.PE151

CP001606.PE151       Location/Qualifiers
FT   CDS_pept        complement(176886..177617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47116"
FT                   /protein_id="ACS47116.1"
FT                   /translation="MEGKQPKLTPEQREAIDTLSSTPQYQGESKIKIFMKIPAKDKAAY
FT                   SRTHFLVPLLAAVIVIALGTFVIVRLVSPVPRPALYAAAVSGSTPMGEADKLKDDYAKK
FT                   LGKDAIIDDYFDMNKDGLSKLQTMIGNEQIDVVIAPHDVFAKLASFGYFDNLKTTLPAA
FT                   EYAKVGKYAMAFHGFDDSRVTDAIDESGSGQGKSEPYGLLLEHAPRWDRIEGADDDALV
FT                   GIAANTQQLDTAKNFIQYLYN"
     atggaaggca agcagccgaa gctcacgccc gagcagcgcg aagcaatcga cacgttgtcg        60
     tcgacgccgc agtaccaagg ggaatcgaag atcaagatct tcatgaagat tcccgcgaaa       120
     gacaaggccg cgtattcccg cacgcacttc ctggtgccgc tgctcgccgc cgtcatcgtg       180
     atcgcgctcg gcaccttcgt catcgtgcgc ctcgtcagcc cggtaccgcg tcccgcactg       240
     tatgcggcgg cggtgagcgg atcgacgccg atgggcgagg ccgacaaact caaggacgac       300
     tatgcgaaga aactcggcaa agacgcgatc atcgacgact atttcgacat gaacaaagac       360
     ggtctgtcga aattgcagac gatgatcggc aatgagcaga tcgacgtcgt catcgcaccg       420
     cacgacgtgt tcgcgaaact ggcgagcttc gggtacttcg acaatctcaa gaccacgctg       480
     cccgccgcgg aatacgcgaa ggtgggcaaa tacgccatgg cgttccatgg attcgacgac       540
     tcgcgcgtga ccgacgcgat cgacgagtcg ggcagcgggc agggcaagtc cgagccgtac       600
     ggcctgctgc tcgagcatgc gccgcgctgg gaccgcatcg aaggcgcgga cgacgacgca       660
     ctcgtcggca tcgccgcgaa cacccagcaa ctcgacaccg ccaagaactt catccaatac       720
     ctgtacaact aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page