(data stored in ACNUC30630 zone)

EMBL: CP001606.PE159

CP001606.PE159       Location/Qualifiers
FT   CDS_pept        187744..189288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0163"
FT                   /product="amino acid permease"
FT                   /note="COG1113 Gamma-aminobutyrate permease and related
FT                   permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47124"
FT                   /protein_id="ACS47124.1"
FT                   /translation="MSDVQQPAEPHETPHEEEVNASLETLDKDNEMERGLSNRHVQFIA
FT                   IGGAIGTGLFLGSGKSINLAGPNIIFVYILVGGIMFLMMRAIGELMYRDPSQHTFINFI
FT                   RFYLGDGWGKFALWSYWIVLILIGMTEITAVGQYCVTFFRTLGYDVSAWKGLIELGFLL
FT                   LLVMINLIAVKAFGEAEFWFSMIKITLIVAMIATAVIMLVCGFKYNAVQVPGQDHVSPA
FT                   GSVTLDNLTRGFSLAPNGWLAFLMSFQMVFFAYEMIEFMGVTVSETKNPRKVLPKAING
FT                   IIVRVLIFYVGALLAIMTIVPWRNFRPNKDGSFASPFIMVFEYAGANWAAALVFFVVVT
FT                   AAASSLNSLLYSAGRHLYEIAEDSPSPAIAKLGVVSKTKVPARAIIASAILVLLSPVIE
FT                   MIPRVSGAFVMFSSASSAVIIFIYILTMIAHYRYRNSPQFMANGFRMPAYRVLNPLTTA
FT                   FFVFIYCTLFIGADTRGPAIAGLVWLVVFGGYCVLHERFQNRDLKQSIDSAGDAHA"
     atgtcggatg tgcagcaacc agcggaacct catgagaccc ctcacgaaga ggaagtgaac        60
     gcctcgctcg agacgctcga caaagacaac gagatggaac gtggcctgag caatcgccac       120
     gtgcagttca tcgcgatcgg cggtgcgata ggcacgggcc tgttcctcgg ctccggcaag       180
     tcgatcaatc tggccggccc gaacatcatt ttcgtctaca ttctcgtggg cggcatcatg       240
     ttcctcatga tgcgcgcgat cggcgaactg atgtaccgcg acccgagcca gcacacgttc       300
     atcaacttca ttcgcttcta tctgggtgac ggatggggca agttcgcgct gtggtcgtac       360
     tggatcgtgc tcattctcat aggcatgacc gagatcaccg ccgtggggca gtactgcgtc       420
     acgttcttcc gcacgcttgg gtacgacgtc tccgcgtgga aggggctcat agaactcggg       480
     ttcctgctgc tgctcgtcat gatcaatctc attgccgtca aggcgttcgg cgaggcggag       540
     ttctggtttt cgatgatcaa gatcacgctg atcgtggcca tgatcgccac ggccgtgatc       600
     atgctcgtct gcggtttcaa atacaacgcc gtgcaggtgc ccgggcagga ccatgtgtcg       660
     ccggccggca gtgtgacgct cgacaatctg acccgtggat tctcgctcgc gccgaatggc       720
     tggctggcgt ttctgatgag cttccagatg gtcttcttcg cctatgagat gatcgaattc       780
     atgggcgtca ccgtctccga gacgaagaac ccgcgcaagg tgctgccgaa ggcgatcaac       840
     ggcatcatcg tgcgcgtgct catcttctac gtgggcgcgt tgctggcgat catgacgatt       900
     gtgccgtggc gcaacttccg cccgaacaaa gacggctcct tcgcctcgcc gttcatcatg       960
     gtgttcgaat acgcaggcgc gaactgggcg gccgccctcg tgttcttcgt ggtggtcacg      1020
     gccgccgcct cgtcactcaa ctcgctgctg tattcggctg ggcgccatct gtatgagatc      1080
     gccgaggatt ccccgtcgcc tgcgattgcg aaactcggcg tcgtctcgaa gacgaaggtg      1140
     ccggcgcgcg cgatcatcgc atcggcgatc ctcgtgctgc tctcgccggt catcgagatg      1200
     atcccgcgcg tctcgggcgc tttcgtcatg ttctcgtcgg cgtcgtcggc cgtgatcatc      1260
     ttcatttaca tattgacgat gatcgcgcac taccgttacc gcaattcgcc gcagttcatg      1320
     gctaacgggt tccgcatgcc ggcgtaccgc gtgctcaacc cgctcaccac cgcgttcttc      1380
     gtgttcatct actgcacgct gttcattggg gcagacaccc gcggaccggc gatcgccggt      1440
     ttggtgtggc tcgtggtgtt cggtggctac tgcgtgctgc atgagcgctt ccagaaccgc      1500
     gatctcaagc agtccataga ttccgcgggc gatgcgcacg cgtag                      1545
//

If you have problems or comments...

PBIL Back to PBIL home page