(data stored in ACNUC30630 zone)

EMBL: CP001606.PE163

CP001606.PE163       Location/Qualifiers
FT   CDS_pept        complement(191615..192037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0167"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47128"
FT                   /protein_id="ACS47128.1"
FT                   /translation="MDWFDKVVSVVKLQNRLDHRPSQLSGGQQQRVACARAIMERPSVI
FT                   FADEPTGNLDSRSSHEVFEFLRMCVREYGQTIVMVTHDPRAASFADRVLVLSDGSIVQD
FT                   LDHPSYDDILAVFAQDDDPQNGPVEVESATARSAEQ"
     atggattggt tcgacaaagt ggtgtcggtg gtcaagttgc agaaccgtct cgaccatcgc        60
     ccgagccagc tgtccggcgg ccaacagcag cgcgtcgcct gtgcgcgggc gatcatggag       120
     cggccgagcg tgatcttcgc cgacgaaccg accggcaacc tcgattcgcg gtcgagccat       180
     gaggtgtttg aattcctgcg catgtgcgtg cgcgaatacg ggcagacgat cgtgatggtg       240
     acgcacgacc cgcgtgccgc gtcgttcgcc gaccgcgtgc tcgtactgtc ggacggcagc       300
     attgtgcagg acctcgacca tccgtcgtac gacgacattc tcgcggtgtt cgcgcaggac       360
     gacgacccgc agaacggtcc ggtggaggtg gagtctgcaa cggcaaggag cgcggaacaa       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page