(data stored in ACNUC30630 zone)

EMBL: CP001606.PE168

CP001606.PE168       Location/Qualifiers
FT   CDS_pept        complement(199138..199827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0172"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /note="COG0671 Membrane-associated phospholipidphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47133"
FT                   /protein_id="ACS47133.1"
FT                   /translation="MDSLFVRKHCWQIIGALSLIGALWFTIAVCRFHILGMDTAVYGWI
FT                   TAHVMTPGMTSVMRMLTQLSGSITVIVVAAVALAVLAVVKRWKIGVAVAVNLAGIYVLN
FT                   EIIKHIVRRPRPDFPHLVFEQGYSFPSGHAMVSTAFYGFIVYLLYRYWHTARDSGARVG
FT                   KIVAIVLLCLIPPVVMFTRVYLGVHYASDVCAGLLFAIAWLTLFYVPAMKRTLLKRASP
FT                   AASPTKR"
     atggattcgc tgttcgtgag gaaacattgt tggcagatta tcggcgcgct gagcctgatc        60
     ggcgcgctgt ggttcacgat cgcggtgtgc cggttccaca tactcggcat ggacaccgca       120
     gtatacggct ggatcaccgc gcatgtgatg acccccggca tgaccagcgt gatgcgcatg       180
     ctcacccagc tttccgggtc gatcaccgtg atcgtcgtgg cggcggtcgc gctcgccgtg       240
     ctggccgtgg tgaagcgctg gaaaatcggt gtggctgtgg ccgtcaatct cgcgggcatt       300
     tatgtgctca acgagatcat caaacacatt gtgcgccgtc cacgcccgga tttcccgcat       360
     ctcgtgttcg agcaggggta cagtttccct tccggccacg cgatggtgag cacggcgttc       420
     tacggattca tcgtctacct gctgtaccgc tactggcaca ccgcgcgcga ttcgggcgcc       480
     cgcgtgggga agatcgtcgc aatcgtgctg ctgtgcctga tcccgccggt cgtcatgttc       540
     accagggtct atttgggcgt gcattacgcg agcgacgtgt gcgcgggcct cctgttcgca       600
     atcgcctggc tcacactgtt ctatgtgccg gcgatgaagc gcacgctgct caaacgcgcg       660
     tctccggctg catccccaac gaaacgctga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page