(data stored in ACNUC30630 zone)

EMBL: CP001606.PE174

CP001606.PE174       Location/Qualifiers
FT   CDS_pept        complement(206747..209515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0178"
FT                   /product="putative phage infection protein"
FT                   /note="COG1511 Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47139"
FT                   /protein_id="ACS47139.1"
FT                   /translation="MRNIWFILRRDLKRLIINPAAWVIIFGLTFIPALYAWFNIIGFWN
FT                   PYGNTKGITVAVANEDAGADNAMMGKLELGDQIESTLKENHELGWTFLGKAKAMECVES
FT                   GHCYAAIVIPRNFSENMAAVITGSGQRPTLEYYVNEKVNAVAPKMTDVGANTVDRQVNS
FT                   AFVSTVSKAVTDTINTTNVQITQEGNATVAQTVAKLDATKANLSKSRTMIADLRKTLDG
FT                   VDEKTTAAKQALAGVDSAATSASQGLTSASGLLTKTQGGITSFSNDLSTELDQGGNLFL
FT                   QASGKASTSATRVANGVLTASGATGSALNELTSVNKTNAQILADLKALPDNPLSEQINE
FT                   IVTDLSAENEKVAQTLQTLTTLNDSTTAAANSTLGTVDQFSATSTTTVDALSGARNTIN
FT                   SSAIPQLNSGLATLSGTAGTLSGFLTGTQSLTGQTNLILDQLTQICQSTSSSLNSTDDL
FT                   LGKFITRIDTVTTDLKTLENTNVLSDLLGSKNGTLDASRIASFMLSPTVLDTHTLYPID
FT                   TYGSGMAPLFTSLALWVGVFMLMVLFKLEVDNEGLEGRHVTTNQTYMARYLLLAIVAGL
FT                   QGIVCAVGDLIIRVQCANRFVFILTAWLTSLAYLAIAYALSATFMHVGKALVVALVMLQ
FT                   IPGASGLYPIEMMPDFYRALYPFFPFTYSINAFRETIAGFYDGDWLTKMLMLALFTAIA
FT                   FFVGLVVRPWLGNFNHLFAREVHEGDMIVGERVYMPANRFDLAQALHVLADHGEYRRRI
FT                   ERRAKRFATLYPRLMRGALVAGFAVPIVLFIVFSFVGASDGSKLVALATWIAWILIIII
FT                   FLMTVESIRESLRRQTELGSLSEDSLRDMIMAQGVFGNNRHHITVPADELRPDAASNSR
FT                   ERAEKRREERDLNHREDTLDLNLNELRKPERQRKHRGSTSRRNHHDGRHSA"
     atgcgcaaca tatggttcat tctgcggcgc gacctcaagc gactcatcat caatccggcc        60
     gcctgggtga tcatcttcgg cctcaccttc attcccgcgc tctacgcctg gttcaacatc       120
     atcggcttct ggaatccata cggcaacacg aaaggcatca ccgtggccgt ggcgaacgaa       180
     gacgccggcg ccgacaacgc catgatgggc aagctcgagc tcggcgacca gatcgagagc       240
     acgctcaaag agaaccacga gctcggctgg accttcctgg gcaaggcgaa ggccatggaa       300
     tgcgtggaat ccgggcattg ctacgccgcc atcgtgatcc cgcgcaactt cagcgagaac       360
     atggccgccg tgatcaccgg cagcggccaa cgccccacgc tcgaatacta cgtgaacgag       420
     aaagtgaacg ccgtcgcgcc gaaaatgacc gacgtcggcg cgaacaccgt ggaccgccaa       480
     gtgaacagcg ccttcgtctc caccgtgagc aaggcggtca ccgacacgat caacacaacg       540
     aatgtgcaga tcacacagga gggcaacgcc accgtggcgc agaccgtggc gaagctcgac       600
     gccacgaagg ccaatctgag caaatcgcgc acgatgatcg ccgatctgcg caagacactc       660
     gacggcgtgg acgagaagac cacggccgcc aaacaggcgc tcgccggcgt cgactcggcc       720
     gccacaagcg cctcccaagg actcaccagc gcatccggcc tgctcacgaa aacgcagggc       780
     ggtatcacct cgttcagcaa cgacctgtcc accgaactcg accaaggcgg caatctgttc       840
     ctgcaggcga gcggcaaggc gagcacatcg gccacccgtg tcgccaacgg cgtgctcacc       900
     gcaagcgggg ccaccggcag cgcactcaac gaactcacca gcgtgaacaa gacgaacgcg       960
     cagatcctcg ctgacctcaa agcgctcccc gacaacccgc tgagcgagca gatcaacgag      1020
     atcgtcaccg acctgagcgc cgagaacgaa aaggtcgcgc aaacactgca gacgctcacc      1080
     accctcaacg actccaccac cgcagccgcg aacagcacgc tcggcacggt cgaccagttc      1140
     tccgcgacgt caacgaccac ggtcgacgcg ctctccggcg cacgcaacac gatcaattcg      1200
     agcgcgatac cgcagctcaa ttccggactc gccacgcttt cgggcaccgc aggcacgctc      1260
     tccggcttcc tcaccggcac acagtcgctc accgggcaga cgaacctgat cctcgaccag      1320
     ctcacgcaga tctgccaatc cacctccagc tcgctcaaca gcaccgacga cctgctcggc      1380
     aagttcatca cacgcatcga caccgtgacc accgatctga agacgctcga gaacacgaac      1440
     gtgctctcgg acctgctcgg cagcaagaac ggcacactcg acgcctcgcg gatcgcctcg      1500
     ttcatgctct cacccaccgt gctcgacacg catacgctct acccgatcga cacgtacgga      1560
     tccggcatgg cgccgctgtt cacgagtctg gcgctatggg tgggcgtgtt catgctcatg      1620
     gtgctgttca agctcgaagt ggacaacgaa ggccttgaag gacgccatgt gacgacgaac      1680
     cagacctaca tggcacgcta cctactgctg gcgatcgtcg ccggactgca gggcatcgta      1740
     tgcgcggtgg gcgacctcat catacgcgtg caatgcgcga accggttcgt cttcatactc      1800
     acggcatggc tcacctcgct cgcttacctg gccatcgcct acgcgctgtc cgccacgttc      1860
     atgcatgtgg gcaaggcgct cgttgtcgcg ctcgtcatgc tgcagattcc cggcgcctcc      1920
     ggcctctacc ccatcgagat gatgccggac ttctaccgcg cgctctaccc gttcttcccg      1980
     ttcacctact cgatcaacgc gttccgcgag acgatcgccg gattctacga cggcgactgg      2040
     ctgacgaaga tgctcatgct cgccttgttc acggccatcg cgttcttcgt gggactcgtg      2100
     gtgcgcccct ggctcggcaa tttcaaccac ctgttcgccc gcgaggtgca tgagggcgac      2160
     atgatcgtcg gcgagcgcgt gtacatgccc gccaaccgct tcgacctcgc gcaggcgctc      2220
     catgtgctcg ccgatcacgg tgaataccgc aggcgcatcg aacgccgcgc caagcgtttc      2280
     gccacactct acccgcggct gatgcgcggc gcgctcgtgg ccggtttcgc ggtgccgatc      2340
     gtcctgttca tcgttttctc gttcgtcggc gcctccgacg gctcgaagct cgtggcgctc      2400
     gccacatgga tcgcgtggat tctgatcatc atcatcttcc tgatgacggt cgagtcgatc      2460
     cgcgaatcgc tgcgccggca gaccgagctt ggctcgctga gcgaggattc gttgcgtgac      2520
     atgatcatgg cgcagggcgt gttcggcaac aaccggcacc acatcaccgt gccggcggac      2580
     gagctcaggc cggacgcggc gagcaacagc cgcgaacgcg ccgagaagag gcgcgaggag      2640
     cgcgatctga accatcggga agatacgctc gacctcaatc tcaacgaact gcgcaaaccg      2700
     gaacggcaga ggaagcaccg cgggagcaca agccggcgca accaccacga cgggaggcac      2760
     tcggcatga                                                              2769
//

If you have problems or comments...

PBIL Back to PBIL home page