(data stored in ACNUC30630 zone)

EMBL: CP001606.PE196

CP001606.PE196       Location/Qualifiers
FT   CDS_pept        complement(235106..235831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47161"
FT                   /protein_id="ACS47161.1"
FT                   /translation="MHSGSGSIIASRSAFTHTGSPRPARPGQLDQAIAEGLASDVDPER
FT                   LREVAHTTAWALLSKVHKTDDPAIVERVLTLVDREGVDVIAELWSKAEPDSLPGVLWRL
FT                   YLLRSWMRKQRDTIARLWRLGEPIATSASAIAGVDSAPTEDDIARTADSILTGAFRGDF
FT                   AVALTRASVFVGIVALGLRVEARELTQQANLNPVGSAAEQSKRWRTQAAQLLHTAANLN
FT                   ITSKDFKHGAALWRQGKLE"
     atgcattccg gctccggctc gattatcgcg agccgctccg cattcacgca cacgggctcg        60
     ccccgccccg cgcgccccgg ccagctcgat caggcgattg ccgagggact ggccagcgac       120
     gtcgatcccg agcgcctgcg cgaagtcgcc cacacgaccg cctgggccct gctgagcaag       180
     gtgcacaaga ccgacgaccc tgccattgtg gagcgcgtgc tcacgctggt ggaccgcgag       240
     ggggtcgacg tgatcgccga actgtggagc aaagcggagc cggactcgct gcccggcgtg       300
     ctgtggcgct tgtatctgct gcggtcgtgg atgcgcaagc agcgcgatac aatcgcccgg       360
     ctatggcgcc tgggcgagcc gattgccacc tccgcctccg cgatcgccgg cgtggactcc       420
     gcccccaccg aagatgacat cgcgcgcact gcggactcga ttctcaccgg cgcgttccgc       480
     ggggatttcg cggtcgcgtt gacgcgcgca tcggtgttcg ttggcatcgt cgcactcggg       540
     ttgcgcgtcg aggcgcgcga gctcacgcag caggcgaatc tgaatcctgt aggttccgcc       600
     gccgagcaga gcaaacggtg gcgcacgcag gccgcgcaac tgctgcatac cgcggcgaat       660
     ctgaacatca cgagcaagga tttcaagcac ggcgcggccc tgtggcgtca aggcaagctc       720
     gagtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page