(data stored in ACNUC30630 zone)

EMBL: CP001606.PE244

CP001606.PE244       Location/Qualifiers
FT   CDS_pept        complement(301754..302569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0251"
FT                   /product="hypothetical protein"
FT                   /note="COG0668 Small-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47209"
FT                   /protein_id="ACS47209.1"
FT                   /translation="MLDWLKANSGRIIFLAIVIALAFVVTRLLSRGLRKVLEHNKIPQA
FT                   SIFINIARVLVWVVALTIVLHPVFGVSPASLFTALGIGGLAISLGLKDSIANTIGGFTL
FT                   MFSHVIQPGDTVSINDTTGVVQDINWRQTVVRERNGNLMMIPNSVLNTTALEKLDPANE
FT                   CLVTIPFTAKPDVDTAKLAQDLLSTVNTHARSLMNPKYKAVVRYTGFTSDGVSGNIVAY
FT                   AKHGVALTALSDAIARAVHSSKLNLNFTASSLVGIDESGALTGKSTSRS"
     gtgcttgact ggttgaaggc gaacagtggg aggatcatct tcctcgccat cgtcatcgcg        60
     ttagcattcg tggtgacgcg tttgctgagc cgtggcctgc gcaaggtgct cgagcacaac       120
     aagatcccgc aggcgtcgat cttcatcaac atcgcgcgcg tgctcgtctg ggtggtcgcg       180
     ctcaccatcg tgctgcaccc ggtgttcggc gtgagcccgg cgagtctgtt caccgcgctc       240
     ggcataggcg gcctggccat ctcactcggc ctgaaggact ccattgcgaa cacgatcggc       300
     ggattcacgc tcatgttctc gcatgtgatc cagccaggcg acacggtgag catcaacgac       360
     acgaccggcg tggtgcaaga catcaactgg cggcagaccg tggtccgcga gcgcaatggc       420
     aatctgatga tgatcccgaa ctcggtgctc aacaccaccg cgctggagaa gctcgacccg       480
     gcgaacgagt gcctggtcac gatcccgttc accgccaagc ctgacgtcga cacggccaag       540
     ctcgcccagg atctgctgag cacggtgaac acgcacgcgc gctcgctcat gaacccgaaa       600
     tacaaggcgg tcgtacgcta caccggcttc acgagcgacg gcgtgagcgg caacatcgtg       660
     gcctacgcga agcacggcgt cgcgctcacc gcgctgtcgg acgccatcgc gcgcgcagtg       720
     cacagttcca agctcaatct gaacttcacg gcgtcctcat tggtcggcat tgacgaaagc       780
     ggtgcgctca ccggcaaatc tacatcacgt tcataa                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page