(data stored in ACNUC30630 zone)

EMBL: CP001606.PE288

CP001606.PE288       Location/Qualifiers
FT   CDS_pept        363052..364038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0297"
FT                   /product="SalX-type ABC antimicrobial peptide transport
FT                   system ATPase component"
FT                   /note="COG1136 ABC-type antimicrobial peptide transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47253"
FT                   /protein_id="ACS47253.1"
FT                   /translation="MNAMQNNNPGAPMPQAPQNAPHPLPQTPADAMPHNGYAPQPPMTA
FT                   APMPYPDGAPMGGQSLALQGIDLVMDYNTSASGNPAATQPAAWQMGQPLALNHANFQLG
FT                   EGERVAIMGPSGSGKSTLLHVLAGIMKPTAGQVLFRGANIDRIPDAERTRMRRQAFGFV
FT                   FQSGQLLPELPAIENVALPLMLGGMAYSQATDQAAMWLERMGLRNLMRNRPGQMSGGQM
FT                   QRVAIARALCVNPAIIFADEPTGALDQNTGHEVMNLLMQAAAANNAAVVLVTHDPNIAA
FT                   YCDRTVSMRDGMILDAANRRAGMQRQPQNDAPAQAVQMGAQPQGALQ"
     atgaacgcaa tgcagaacaa caatcccggc gcgccgatgc cacaggcgcc gcagaacgcg        60
     ccgcatccct tgccgcaaac ccccgcagat gccatgcccc acaacgggta tgctccacag       120
     cccccaatga ctgcggcacc catgccgtac cctgacggag cgccgatggg aggccaatca       180
     ctcgcgctgc agggaatcga cctggtgatg gattacaaca caagcgcttc cggcaacccg       240
     gcggcgacac aacccgcggc atggcagatg ggtcagccac tcgcgctgaa ccacgcgaac       300
     ttccagcttg gcgaaggcga acgcgtggcg atcatgggac cgtcgggttc gggcaaatcg       360
     acgctgctgc atgtgctcgc cggcatcatg aagccgacgg ccggccaagt gctgttccgc       420
     ggtgccaaca tcgaccgcat tccggacgcc gaacgcaccc gcatgcgcag gcaggcgttc       480
     ggattcgtct tccaatccgg gcaactgctg ccggagctgc cggcgatcga aaacgtggca       540
     ttgccgctca tgctcggcgg catggcgtac tcgcaggcga ccgatcaggc cgccatgtgg       600
     ctggaacgca tgggattgcg caatctgatg cgcaatcgac ccggccagat gagtggcggc       660
     cagatgcaac gcgtcgccat tgcgcgcgca ctatgtgtga atccggccat catcttcgcc       720
     gacgagccga ccggcgcgct cgaccagaac accgggcacg aggtgatgaa tctgctcatg       780
     caggcggcgg ccgcgaacaa cgccgcagtg gtgctcgtca cccacgaccc gaacatcgcc       840
     gcatactgcg accgcaccgt gagcatgcgc gacggcatga tcctcgacgc ggccaaccgg       900
     cgcgcaggca tgcagcgcca accgcagaac gacgccccgg cacaggcagt gcagatgggc       960
     gcccaaccac aaggagcgtt gcaatga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page