(data stored in ACNUC30630 zone)

EMBL: CP001606.PE290

CP001606.PE290       Location/Qualifiers
FT   CDS_pept        complement(365643..366584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0299"
FT                   /product="hypothetical protein"
FT                   /note="COG0679 Predicted permeases"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47255"
FT                   /protein_id="ACS47255.1"
FT                   /translation="MGGLISAMEGFCVIGIVIAAGYAAARLQIGGAQAQYVFNRLSFFI
FT                   ASPCLMFAILAQENITHLFDSTIIVAFCSAVGVGLVFLVLNRLFFHLKAPDATIGVLNS
FT                   LYLNSNNIGLPIATYILGNPALVAPILVMQQALFTPVGLTVLDVTTKGKFSVKQVLKQP
FT                   LHQPLLIGTVLGIIVSVVSSKVGHFIVPNFLFDPIDMIGDSAVPMILMAFGMSLHGTKP
FT                   MQNKSNLPAIWTVAALKNIVMPLIAFGIAFAMGFRGPTLYGCVVLAALPTGQNVYNYAA
FT                   RYNVGMTFARDGILISTMTSPIVIAIIAALLS"
     atgggcggcc tcatcagcgc aatggaggga ttctgcgtca tcggcatcgt gatcgcggcc        60
     ggctatgcgg ccgcgcgtct gcagatcggc ggcgcccagg cacagtatgt gttcaatcgc       120
     ctgagcttct tcattgcgag cccgtgcctc atgttcgcca ttctggcgca ggagaacatc       180
     acacatctgt tcgattccac gatcatcgtc gcgttctgct cggcggtcgg cgtcggactc       240
     gtcttcctcg tgctcaacag attgttcttc cacctcaagg caccggatgc cacgatcggc       300
     gtgcttaact cgctgtattt gaattcgaac aacatcggcc tgcccatcgc cacgtacatt       360
     ctcggcaacc cggcgctcgt cgcgcccatt ctcgtcatgc agcaggcgct gttcacgccg       420
     gtcggactca ccgtgctcga cgtgaccacc aagggcaagt tctcggtgaa gcaggtgctc       480
     aagcagccgt tgcaccagcc attgctcatc ggcaccgtgc tcggcatcat cgtctcggtc       540
     gtctcgtcga aggtgggcca tttcattgtg ccgaacttcc tgttcgaccc gatcgacatg       600
     attggagatt ccgcggtgcc gatgatcctc atggcattcg gcatgtcgct gcacggcacg       660
     aagccgatgc agaacaagtc gaatctgccg gcgatctgga cggtggcggc gctcaagaac       720
     atcgtgatgc cgctcatcgc attcggcatc gccttcgcca tgggcttccg cgggcccacg       780
     ctgtacggct gtgtcgtgct cgccgcactg cccaccggcc agaacgtgta caactacgcg       840
     gcccgctaca atgtcggcat gaccttcgcg cgcgacggca tactcatctc cacgatgacg       900
     agccccatcg tcatcgcgat catcgccgcg ctcctcagct ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page