(data stored in ACNUC30630 zone)

EMBL: CP001606.PE303

CP001606.PE303       Location/Qualifiers
FT   CDS_pept        381646..382542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0313"
FT                   /product="hypothetical protein"
FT                   /note="COG0340 Biotin-(acetyl-CoA carboxylase ligase)"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47268"
FT                   /protein_id="ACS47268.1"
FT                   /translation="MTTELNGDYRRAREKAHVISLDTVTSTNDYAAQLVADGRLDRNGM
FT                   TIVLAREQTQGRGRLDHTWVSVPGKSFIASVICIVNADTAKDPQVNGWLQMIAGMSVID
FT                   ALRETVMSANMDWLDHTRGNPSMRSELQLKWPNDIVYQGMKLGGILAQLVQIPGDENSV
FT                   AIIFGVGLNLDLAPDQLPTAQSTSLQLIASCVNGAACVPADQLADMIAAGLVNALSKRL
FT                   WYFGENPAGYAQNLHRRIAEECWTLGKPVLVHRTDGTTLTGEAVAINEDASLSVRDDSG
FT                   QVHVVRTGDVGVLPVED"
     atgacgactg aactgaacgg cgactaccgg cgcgcccgtg agaaggcgca tgtgatttcg        60
     ctggataccg tgacctcgac caatgactat gccgcacagc tcgtcgctga cggcagactc       120
     gaccgcaatg gcatgaccat tgtactggcg cgcgagcaga cgcagggcag gggcagactc       180
     gaccacacct gggtctcggt gccaggcaaa tcgttcatcg cttccgtgat ctgcatcgtg       240
     aacgccgata ccgcaaagga cccgcaggta aatggctggc tgcagatgat cgccggcatg       300
     tcggtgatcg acgcccttcg cgagaccgtg atgtcggcga atatggattg gctcgaccac       360
     accaggggca acccctccat gcgcagcgaa ctccagctca aatggcccaa cgacatcgtc       420
     taccaaggca tgaagctcgg cggcatactc gcgcagctgg tgcagattcc cggtgacgag       480
     aacagtgtgg cgatcatctt cggcgtcggg ctcaacctcg atctcgcccc cgaccagctg       540
     cccaccgcgc agtcgacgtc gttgcagctg atcgcctcgt gcgtcaacgg cgcggcctgc       600
     gtgcctgccg atcagttggc cgatatgatc gccgccggac tcgtcaacgc cctgtcgaaa       660
     cggttgtggt acttcggcga gaacccggcc ggttacgcgc agaatctgca caggcgcatc       720
     gctgaggaat gctggacact aggcaagccg gtgctcgtgc accgcacgga tggcacgacg       780
     ctgacgggcg aggcggtcgc aatcaacgaa gacgcctcgc tgagcgtgcg cgacgacagc       840
     ggccaagtgc atgtggtgcg caccggcgac gtgggcgtgc tgccagtgga agactga          897
//

If you have problems or comments...

PBIL Back to PBIL home page