(data stored in ACNUC30630 zone)

EMBL: CP001606.PE305

CP001606.PE305       Location/Qualifiers
FT   CDS_pept        383489..385363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0315"
FT                   /product="JadJ"
FT                   /note="COG4770 Acetyl/propionyl-CoA carboxylase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47270"
FT                   /protein_id="ACS47270.1"
FT                   /translation="MTDTVSKLLIVNRGEIALRVVRTAREMGIPTVVVYAEQDRHSQYV
FT                   KMADEAFLLSGDTYADTYLNEDLLIDILRRSGADAVHPGYGFLSEVPSFADKVIEAGAT
FT                   WVGPSSRALTDLGDKISARRVAVYAKVPPVPGISHSLGDMRVLLDFAHTHGYPLMLKRA
FT                   DGGGGRGITLVRDDDELRGFYLNHNAVQGGDLDEYFVERFIDHGRHVETQCGRDSHGNF
FT                   TVYSTRDCSVQRRNQKLIEEAPAPFLGDDVVEQLHAYSHRLFDAVDYVGLGTCEFMVTD
FT                   AGKVYFLEVNPRLQVEHTVSEEVSGLDLVREQLQIAAGGKVSPEPTARGHSFELRITSE
FT                   DPKTNLTPSSGTLERVQWPAGPGVRVDSGVVEGDTISPKFDSMMGKLIVTAHSRQAAVA
FT                   RVRRALDELRIEGVPTPVELYRQVFGDDEFTAEHGHGFDVSTKWLERKYLNHEPATVHG
FT                   GQPASLDAGAGAAEPELDHSEQFVIEMNNRRVVLNVPSDMFANLTGAARSHGERRPTQP
FT                   LRGQGSHHVDRGNARTAERPGVISAPMQALVTRINVSEGQQVAKGDLLVVLESMKMENY
FT                   VYSPANGTVKEIFASPATGVEAGETLLTMEVAGTSKPANPTTDTTEEA"
     atgaccgata ctgtctccaa actactcatc gtcaaccgcg gcgagatcgc cctgcgtgtg        60
     gtgcgcaccg cgcgtgaaat gggcatcccc accgtggtcg tgtacgccga gcaggaccgc       120
     cattcgcaat atgtcaagat ggcggacgag gcattcctgc tctcgggtga cacctacgcc       180
     gacacctacc tcaacgaaga cctcctcata gacattctcc ggcgttccgg cgccgacgcg       240
     gtgcacccgg gctacggatt cctctccgaa gtgccgagtt tcgccgacaa ggtgattgag       300
     gccggcgcca catgggtcgg cccgtcgtcg cgcgcgctca ccgatctggg agacaagatc       360
     agcgcacgcc gcgtggccgt gtacgccaag gtgccgccgg tgccgggcat ctcgcattcg       420
     ctcggcgaca tgcgcgtgct gctcgacttc gcacacacgc acggctaccc gctcatgctc       480
     aagcgcgcgg acggcggcgg cggacggggc atcacgctcg tgcgcgacga cgacgagctg       540
     cgcggcttct acctgaacca caacgccgtg cagggcggcg acctcgacga gtacttcgtg       600
     gagcgtttca tcgaccatgg caggcatgtg gagacccaat gcggccgcga ttcgcacggc       660
     aacttcaccg tgtactcgac gcgcgactgt tcggtgcagc gccgcaacca gaagctcatc       720
     gaggaggcgc cggccccgtt cctgggcgac gacgtggtcg agcagctgca tgcctattcg       780
     caccggctgt tcgacgcagt ggactatgtg ggcctgggca cctgcgagtt catggtgacc       840
     gatgcgggca aggtgtactt cctggaggtg aacccgcgcc tgcaggtcga gcatacggtg       900
     agcgaggagg tgagcggact cgatttggtt cgcgaacaat tgcagattgc cgccggcggc       960
     aaggtctcac cggaaccgac cgcgcgcggc cacagtttcg aactgcgcat caccagcgag      1020
     gacccgaaga cgaacctgac ccccagctcc ggcacgctcg aacgcgtgca gtggccagcg      1080
     ggacccggcg tgcgggtgga ttccggcgta gtcgaaggag acacgatctc gccgaagttc      1140
     gactcgatga tgggcaagct catcgtgacc gcacatagcc gccaggccgc cgtggcccgt      1200
     gtgaggcgcg cactcgacga gctgcgcatc gaaggcgtgc ccacgcccgt cgaactgtac      1260
     cggcaggtgt tcggcgacga cgagttcacc gccgagcacg gccatggttt cgacgtgagc      1320
     acgaaatggc tcgagcgcaa atacctgaac catgaaccgg ccaccgtgca cggcggccag      1380
     ccggcttcgc tcgatgccgg cgcaggggcg gcggaacccg aactcgacca tagcgagcaa      1440
     ttcgtgatcg aaatgaacaa tcggcgcgtg gtgctcaatg tgccgagcga tatgttcgcc      1500
     aatctcaccg gcgcggcccg ctcgcacggc gaacgcaggc ccacgcagcc attgcggggc      1560
     cagggctcgc accatgtgga ccgcggcaac gcgcgcaccg cggaacgccc gggcgtcatc      1620
     tccgcgccaa tgcaggccct ggtcacgcgc atcaacgtga gcgaaggcca gcaggtggcg      1680
     aagggcgacc tgctcgtggt gctcgaatcc atgaagatgg agaactacgt gtattcgccc      1740
     gcgaacggaa cggtgaagga gatcttcgcc tcgccagcca ccggcgtgga ggccggcgaa      1800
     acactgctga ccatggaggt cgccggaacg tcgaaaccag ccaatcccac caccgacacc      1860
     accgaggagg cgtga                                                       1875
//

If you have problems or comments...

PBIL Back to PBIL home page