(data stored in ACNUC30630 zone)

EMBL: CP001606.PE313

CP001606.PE313       Location/Qualifiers
FT   CDS_pept        402925..403500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0324"
FT                   /product="LemA-like protein"
FT                   /note="COG1704 Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47278"
FT                   /protein_id="ACS47278.1"
FT                   /translation="MSGWIIALIVIAIILVLTIWVIGMYNSLIGMRNRVGNSWAQVDVL
FT                   LKQRADLIPNLVEVVKGYATHESTVFEQVTKARAGVVEVANNPNSTLEQRAAAEQALTN
FT                   AMVNLRAIVEAYPDLKANQNFLDLQGRLASLEDKIAYGRQFYNDTVLKYNNRIMQVPTN
FT                   IIAGMFHFQPAQYFAADEADRSVPQVKF"
     atgagcggtt ggattatcgc gctgattgtg attgcaatca ttctcgtgct gacaatctgg        60
     gtcatcggca tgtacaacag tctcatcggc atgcgcaacc gggttggcaa cagctgggcg       120
     caggtggatg tgctactcaa gcagcgtgcg gatctcattc cgaatctcgt ggaggtcgtg       180
     aaagggtacg ccacgcatga gtcgaccgtg ttcgaacagg tgacgaaagc acgcgccggc       240
     gtcgtggaag tcgcgaacaa cccaaattcc acgctcgagc agcgcgctgc agccgagcag       300
     gcactcacca acgcgatggt gaatctgcgg gcgattgtcg aagcataccc ggacctcaag       360
     gcgaaccaga acttcctcga cctgcaggga cgcctcgcca gcctcgaaga caagatcgcc       420
     tatggccgcc agttctacaa cgacaccgtg ctcaagtaca acaaccgcat catgcaggtg       480
     cccacgaaca tcatcgccgg catgttccac ttccagccgg cccagtattt cgccgcggac       540
     gaggccgatc gctcggtccc gcaagtcaag ttctga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page