(data stored in ACNUC30630 zone)

EMBL: CP001606.PE318

CP001606.PE318       Location/Qualifiers
FT   CDS_pept        complement(409362..409625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0329"
FT                   /product="glutaredoxin-like protein NrdH"
FT                   /note="COG0695 Glutaredoxin and related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47283"
FT                   /protein_id="ACS47283.1"
FT                   /translation="MHITIYSKPNCPQCAATKRAFDRLGAPYTVVDITTDPVALATLQE
FT                   AGFRQAPVVFVDSDFWTGYRPDRIRDVARRLQTVSSASGVLA"
     atgcacatca ccatctattc gaaaccgaac tgcccgcagt gtgcggccac caaacgcgcg        60
     ttcgacagac tcggcgcccc ctacaccgtc gtcgacatca ccaccgaccc ggtcgcgctc       120
     gccacactgc aggaagccgg tttccgtcag gcgccggtag tgttcgtgga ctcggacttc       180
     tggaccggct accgccccga cagaattcgc gatgtcgcac gcagactgca gacggtctcc       240
     tcagcgagcg gcgtgctcgc atga                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page