(data stored in ACNUC30630 zone)

EMBL: CP001606.PE327

CP001606.PE327       Location/Qualifiers
FT   CDS_pept        420925..422928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0338"
FT                   /product="hypothetical protein"
FT                   /note="COG1835 Predicted acyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47292"
FT                   /protein_id="ACS47292.1"
FT                   /translation="MAAGTKVSRDVPRGVAQARHFNGVDGLRAIAIVAIIAYHARPMLL
FT                   KGGFLGVTLFLVVSGFFITRSLMNAVDGHRFLLFDYLRRRVKRLWPAVISTIGLTAVLV
FT                   YACAPPLILKMRGDAVPSALFYSNWSFIFRKLSYFDAAGLPSPLTHLWYTSLIMQFYLL
FT                   WPLLFIPLFLHCRRHWVRVGVLGALIAAGTLEMMMLYRPEADTSRLYYGLDTRAAEILV
FT                   GVLLAMLVHDSASRSDQERRAADGRIVFDRQIGRYHAVLRRGDLGVVAAGICALALALG
FT                   FLLVDARAAWMYHGGFLFFAVVSAVLLYASMQDARVGRILGVKALRYLGSRSFSLYLVH
FT                   YPLLEVMNPATRTTGIPWYEWIGQFLVILMAGEAFYQIVEALTGTPWLPWMRCRITSVG
FT                   AGRLRTSAWILTIVGVVMTFVMALPLDWRAIAHARSVKARPELALTAEQARERLAQQQK
FT                   RESETSKENGKEHKDSSGKPNAQAKPKVAPPVVKALKVPANLEPQRWACDRKAMVCQAK
FT                   VLMIGDSVTEGVSDTLREHFPNATIDGAVSRQFDQGVQILRDDLARGMDPQVIVFALGT
FT                   NGPVSEQMAQQVIDLAGGRPLYFATTRAPVDWVPGNNATFIGMAERNPNVGIIDWSGTS
FT                   QGRDDYLYDDGIHPNQLGMQAYLQMFLNAFCA"
     gtggccgccg gcacaaaagt ttcacgcgat gttccacgcg gcgttgcgca ggcgcgccat        60
     ttcaacggcg tggacggcct gcgtgcaatc gccattgtgg cgatcatcgc ctaccatgca       120
     cgcccgatgc tgctcaaagg cggttttctg ggcgtcacgt tattccttgt cgtctccggc       180
     ttcttcatca cccgttcgct catgaacgcg gtggacggcc atcgcttcct gctgttcgac       240
     tacctgcgca gacgcgtgaa gcggctgtgg ccggcggtga tctcgacgat cggtctgacc       300
     gccgtgctcg tctatgcctg cgcgccgccg cttattctga agatgcgcgg cgatgccgtg       360
     ccgagcgcac tgttctatag caactggtcg ttcattttcc gcaagctctc gtatttcgat       420
     gcggccggct tgccctcgcc gctcacgcac ctgtggtata cgagcctgat catgcagttc       480
     tacctgctgt ggccgctcct attcattccg ctgttcctgc actgccgcag gcactgggtg       540
     cgcgtcggcg tgctgggcgc gctcatcgcc gccggcacgc tcgagatgat gatgctatac       600
     cggccagagg ccgacacctc gcgtctgtat tacggactcg acacccgtgc cgccgagatt       660
     ctcgtgggcg tgctgctcgc catgctcgtg cacgacagcg cctcgcgcag tgatcaggaa       720
     cggcgtgcag ccgacgggcg aatcgtgttc gacagacaga ttggccgata tcacgcggtg       780
     ctgcggcgtg gcgatctggg cgttgtggca gcgggtatct gcgctctggc attggctctc       840
     ggattcctgc tggtggatgc ccgtgccgca tggatgtacc acggcggttt cctgttcttc       900
     gcggtggtga gtgccgtgct gctgtatgcg agcatgcagg atgcacgggt tggccgcata       960
     ctcggtgtga aggcgttgcg ctacttgggt tcgcgttcgt tctcgctcta tttggtgcac      1020
     tacccgctgc tcgaggtgat gaacccggcc acgcgcacca ccggcatacc ctggtatgag      1080
     tggatagggc agttcctggt gattcttatg gcaggcgagg cgttctacca gattgtcgaa      1140
     gcgctgacgg gcaccccgtg gctgccgtgg atgcgttgcc gcatcacctc cgtgggtgcg      1200
     ggcagattgc gcaccagcgc atggattctg acgatcgttg gcgtcgtcat gaccttcgtc      1260
     atggccctgc cgctcgactg gcgagccatt gcgcacgcgc gctccgtcaa ggcgcgtccc      1320
     gagctcgcgc tgaccgccga gcaggcgcgt gaacggctcg cgcagcagca gaagcgcgaa      1380
     tctgaaacca gtaaggagaa cggcaaagag cacaaggact cgagcggcaa gccgaatgcg      1440
     caggccaagc ccaaagtggc gccgccggtg gtcaaggcgc tcaaggtgcc ggcgaatctg      1500
     gagccgcagc gttgggcgtg cgaccgcaag gcaatggtct gccaggcgaa ggtgctcatg      1560
     atcggcgact cggtgaccga aggggtttcc gacacgcttc gtgagcattt cccgaacgcg      1620
     acgatcgacg gtgcggtgag tcgccaattc gaccaaggcg tgcagatcct gcgtgacgat      1680
     ctcgcacgcg gcatggatcc gcaggtcatc gtgttcgcac tcggcacgaa cggtccggtg      1740
     agcgagcaga tggcgcagca ggtgattgac ctcgcgggcg gcagaccgct gtatttcgcg      1800
     acgacgcgcg cgccggtcga ctgggtgccc ggcaacaacg ccacgttcat cggcatggcg      1860
     gaacgaaacc cgaatgtggg catcatcgac tggtcgggca cgtcacaggg gcgcgacgac      1920
     tacctgtacg acgacggcat tcaccccaac caactcggca tgcaggcgta tttgcagatg      1980
     ttcctcaacg cgttctgcgc atga                                             2004
//

If you have problems or comments...

PBIL Back to PBIL home page