(data stored in ACNUC30630 zone)

EMBL: CP001606.PE331

CP001606.PE331       Location/Qualifiers
FT   CDS_pept        426271..426978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0342"
FT                   /product="response regulator of two-component system"
FT                   /note="COG0745 Response regulators consisting of a
FT                   CheY-like receiver domain and a winged-helix DNA-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47296"
FT                   /protein_id="ACS47296.1"
FT                   /translation="MTRILVVEDEPSYLDPLLYQLTREGYEAHGAATGEEAWELYEEME
FT                   FDLVLLDLMLPGISGTTLCRRMHELRRVPIIMVTAKSTENDVIVGLEIGADDYVTKPYS
FT                   FRELLARIHAVLRRSLEPRASGTPGGNDETLTCGPIEMSVASHEVRIHGELTQFPLKEF
FT                   EVLEYLMRNKGRVLTRQQLIGRVWGSDYVGDTKTLDVHVKRIRAKIEADPSNPALLTTV
FT                   RGLGYRICDERSR"
     atgacgcgca ttctcgtggt ggaagacgaa ccttcctacc tcgacccatt gctctaccag        60
     ctcacccgtg aggggtacga ggcccatgga gccgccaccg gggaggaggc gtgggagctg       120
     tatgaggaga tggagttcga cctcgtgttg ctcgacctca tgctgcccgg catctcaggc       180
     accacactct gcaggcgcat gcacgagctg cgccgtgtgc cgatcatcat ggtgacagcg       240
     aaatcaaccg agaatgatgt gatcgtaggg ctcgaaatcg gtgccgacga ctatgtgacc       300
     aaaccgtact ccttccgcga actgctcgcc aggatccatg cggtgttgcg tcgcagtctc       360
     gagccacggg cttctggaac acccggaggg aacgatgaga cgcttacatg cgggcccatc       420
     gagatgtcgg tggcctcgca cgaagtgcgc attcacggtg aactgaccca gttcccgctc       480
     aaggaattcg aggtgctcga atacctgatg cgcaataagg gccgcgtgct caccagacag       540
     cagctgatcg gccgcgtctg gggcagcgat tacgtgggtg acacgaaaac gctcgacgtg       600
     catgtcaagc gcatccgggc gaagatcgag gccgatccgt cgaatccggc actgctgacg       660
     acggtgcgcg gtctcgggta cagaatctgc gacgaacgtt cacgctaa                    708
//

If you have problems or comments...

PBIL Back to PBIL home page