(data stored in ACNUC30630 zone)

EMBL: CP001606.PE335

CP001606.PE335       Location/Qualifiers
FT   CDS_pept        430191..430970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0346"
FT                   /product="phosphate import ATP-binding protein pstB"
FT                   /note="COG1117 ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47300"
FT                   /protein_id="ACS47300.1"
FT                   /translation="MGQQIDIRHLNIYYGSFLAVEDVNLHIAANKVTAFIGPSGCGKST
FT                   VLRTLDRMHEITPGAHVKGDVLLEGKNLYAKDVDPVAVRRDVGMVFQRPNPFPTMSIRE
FT                   NVLAGVSLNNRKISKSDADDLVEWALRGANLWNEVKDRLDNPGIGLSGGQQQRLCIARA
FT                   VAVHPQVLLMDEPCSALDPISTLAVEDLIEELKQDYTIVIVTHNMQQAARIADYTAFFN
FT                   LKAVGQPGHLEYFADTSTMFNNPQNEEAERYVSGRFG"
     atgggacaac aaatcgacat tcgccatctc aacatctatt acggcagttt ccttgcggtc        60
     gaggatgtca atctgcatat cgccgcgaac aaggtgaccg cgttcatcgg gccgtccggc       120
     tgcggcaaat ccaccgtgct gcgcacgctc gaccgcatgc acgagatcac gccgggcgcc       180
     cacgtgaaag gcgacgtgct gctcgagggc aagaaccttt atgcaaagga tgtggatccg       240
     gtggccgtgc ggcgtgacgt gggcatggtg ttccagcggc cgaatccgtt ccccaccatg       300
     tcgatccgtg agaacgtgct cgcgggggtg tcgctcaaca accgcaagat ctcgaagtcg       360
     gatgccgatg acctcgtgga gtgggcgttg cgcggcgcga atctgtggaa cgaggtcaag       420
     gatcgcctcg acaaccccgg catcgggctc tccggtggcc agcagcagcg cctgtgcatc       480
     gctcgcgccg tggccgtgca tccgcaggtg ctgttgatgg acgagccatg ctcggcgctc       540
     gacccgatct ccacgctcgc tgtcgaagat ctcatcgagg agctcaagca ggactacacg       600
     atcgtcatcg tcacgcacaa catgcagcag gccgcccgca tcgcggacta tacggcgttc       660
     ttcaacctca aggccgtggg gcagcccggg cacctggagt atttcgccga tacgtcgacg       720
     atgttcaaca acccgcagaa cgaggaggcc gagcgctacg tttcgggccg cttcggctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page