(data stored in ACNUC30630 zone)

EMBL: CP001606.PE354

CP001606.PE354       Location/Qualifiers
FT   CDS_pept        complement(451287..452603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0368"
FT                   /product="DNA-damage-inducible protein P"
FT                   /note="COG0389 Nucleotidyltransferase/DNA
FT                   polymeraseinvolved in DNA repair"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47319"
FT                   /protein_id="ACS47319.1"
FT                   /translation="MSTAPRIEAAKRDWGHDETGCTILHIDMDAFFASLEIARHPEFRG
FT                   KPVIVGTGNRAVVSAASYEARKYGINSAMPAARAHQLCPNGIFLPVDHHYYSAVSHEIF
FT                   HTVFREVTDRIEQVSVDECYMDVSGALLAWHSPTRIAQWLRAQVAERFGITCSVGIAGN
FT                   KLVAKMASTNAKPNGMLLIPLDKHAQFVQLMPLRGIPGLGPAQEKRLNAWGINSVSQLA
FT                   RCSVEELIQATGSKAAATHLWEASHGIDPCTLTLHAPEKSIGQERTFDTDCNDLATAST
FT                   LIKQCCDKVASILRAKGLMARTLTVKLRFPDLAYSTKQMQLEQPTDAASTLYPHAIDLL
FT                   LRMMGMPADCRGTEVKLTRPIRLAGISTSTLTKREETVIQPTLDELLEENERVAPMPQA
FT                   SSSIPSPANGTRSTRLRCAEEAVDQIRRKFGQDSAHLGA"
     atgagcacag caccgcgtat cgaagctgcc aaaagggatt ggggccatga cgagaccggc        60
     tgcaccatac tgcatatcga catggacgcg ttcttcgcct cgctcgagat agcaagacac       120
     ccggaattcc gcggcaaacc ggttattgta ggaaccggca accgcgccgt ggtctccgct       180
     gcaagctacg aggcccgcaa gtacggcatc aattcggcaa tgccggccgc acgcgcgcac       240
     caactctgcc cgaacggaat cttcctgccc gtcgaccacc actactacag cgccgtctcc       300
     catgagatct tccacacggt cttccgcgag gtgacggacc gcatcgaaca ggtctccgtc       360
     gatgaatgct atatggatgt ctccggtgcg ctgctcgcat ggcacagccc gacgcgcata       420
     gcccaatggt tacgggcgca ggtcgcggaa cggttcggca tcacctgctc ggtgggcata       480
     gccggcaaca aactcgtggc gaagatggcg agcacgaatg cgaagccgaa cggcatgctg       540
     ctcattccgc tggacaagca tgcgcagttc gtgcagctga tgccattgcg aggcattccg       600
     gggcttggcc ccgcccagga gaagcggctg aacgcatggg gaatcaactc cgtgtcccag       660
     ctcgcacgct gttcggtgga ggagctcata caggcgaccg gatcgaaagc cgccgcaaca       720
     cacctgtggg aggcctcgca tggcatcgac ccgtgcacac tcacgctaca cgcccccgag       780
     aaatcaatcg ggcaggaacg caccttcgat acggactgca atgatttggc cacagcgagc       840
     acgctgatca aacaatgctg cgacaaggtt gcctccatac tgcgcgccaa ggggctcatg       900
     gcgcgcacgc tcaccgtgaa actgcggttc cccgaccttg cctactccac caagcagatg       960
     caactggaac aaccgaccga cgccgcgagc acgttgtacc cgcatgccat cgacctgttg      1020
     ttgcgcatga tgggcatgcc ggcggattgc cgcggcactg aggtcaaact cacacgcccc      1080
     atacggctcg ccggcatcag cacgagcaca ttgacaaagc gtgaggagac ggtgatccaa      1140
     cccacgctcg atgaactgct cgaggagaac gagcgtgtgg cccccatgcc acaggcatcg      1200
     tcatcgattc cctcccccgc aaacggcacg aggtcgacac gcctgcgctg cgctgaagag      1260
     gcagtagacc agatccggcg taaattcggg caggatagcg cacatctcgg cgcatag         1317
//

If you have problems or comments...

PBIL Back to PBIL home page