(data stored in ACNUC30630 zone)

EMBL: CP001606.PE36

CP001606.PE36        Location/Qualifiers
FT   CDS_pept        complement(41262..42617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Balat_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Balat_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACS47001"
FT                   /protein_id="ACS47001.1"
FT                   /translation="MSQQFNESRQSWGLFVWNDNGDGQFIRIIDYVTDSAGNGCYDWVA
FT                   YPRWWERSRNPSSDDPLDPKTLYNPKLTQIMVKSDSDFKFLQWTPNYNRPDHPFVEIFQ
FT                   GGLRTTEPPLYEVIDCPANRAEELPDVLSQGIQYSGRPTAKILLLFAENNNMLDAAVLD
FT                   RSMTTIHNGLLTLSNTAPNSVPRVILDRRHVRIINQGFNRGDRLVYNLPTQLKSHSQVV
FT                   IKPMRDLAQLYVNWYIRKEHAMNGDELMRTAGDVLEQAFEKPANLEEYLGAKPSHNDVR
FT                   ALQTAIKATIRSNTDDVSEIIYDVLKNDDDVMAEFRKQATAQLDDEFEKHKQVLCKQLD
FT                   ELRAQRDEESEKAEQATAQLAELNQQLQRKRGEIRDAQAELELQKEEQHKALQDLENNV
FT                   ALKLGLQQIAQQNHSMMEELTIRHSTAPDSSRQLRMAPMMGPAKTQAATDMQ"
     atgtcacagc aattcaacga atctcggcag tcctggggtc tctttgtctg gaacgacaat        60
     ggtgacggac aattcatacg catcatcgat tacgtgaccg attccgcggg gaacggatgt       120
     tatgattggg tggcttatcc gcgctggtgg gaacggtcca ggaacccgtc ttcagatgac       180
     cctcttgacc cgaagaccct atacaaccca aaactcacgc aaatcatggt caagagtgac       240
     tcggatttca agtttctcca gtggacaccg aattacaatc gtccagatca tccgtttgtt       300
     gagatctttc aaggtggcct acgaaccacc gagcctccgc tgtatgaggt gattgattgc       360
     ccggccaatc gtgcggaaga gctacctgac gtgctttcgc aaggcataca gtattccggc       420
     cgtcccaccg cgaaaatcct gctattgttc gcagagaata acaatatgtt ggacgcggcc       480
     gtcctcgacc gcagtatgac aacgattcat aatggcttgc tcacactgag caacacagca       540
     ccgaacagcg tcccacgcgt catcctggat cgccgtcatg tgcgaatcat caatcagggt       600
     ttcaatagag gtgaccgtct ggtatacaat ctgccgacac aactgaagtc tcactctcaa       660
     gtagtgatca agcctatgcg agatctggcg cagttgtacg tgaactggta catccgcaaa       720
     gagcatgcga tgaatggtga cgagctcatg cgcacagccg gagatgttct ggaacaggca       780
     ttcgagaaac cggcgaatct tgaagagtac ctcggtgcca aaccctcaca taacgatgtc       840
     cgggcacttc aaacggcaat caaagcaacc attcgcagca ataccgacga tgtgtctgag       900
     atcatctacg atgtgctgaa aaacgacgac gacgtaatgg cagaattccg gaagcaagcc       960
     actgcgcagc tcgatgacga attcgagaag cacaagcaag tattatgcaa gcagctggat      1020
     gaactgcggg cccagcggga tgaggaatca gaaaaggcgg aacaagcaac tgcacagttg      1080
     gcggagctca atcaacaatt gcagcgcaaa cgtggtgaga tacgcgatgc acaggcagag      1140
     ttggagttgc agaaagagga acaacataaa gcgctgcagg atctggagaa taatgtggca      1200
     ctcaagctcg gcttgcagca gattgcccag cagaatcatt ccatgatgga ggaattgact      1260
     atacggcact cgactgcgcc agattcctcc agacaacttc gcatggcccc catgatggga      1320
     ccagcgaaaa cacaagcagc aacagatatg caatag                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page